SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017145 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017145
Domain Number 1 Region: 10-202
Classification Level Classification E-value
Superfamily E set domains 1.93e-72
Family RhoGDI-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017145   Gene: ENSTNIG00000014135   Transcript: ENSTNIT00000017361
Sequence length 203
Comment pep:known_by_projection chromosome:TETRAODON8:18:1487190:1491518:1 gene:ENSTNIG00000014135 transcript:ENSTNIT00000017361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDEVTPEQLAAIAAENEEPEPVNYKPPAQKSVKEIQDLDKDDESLCKYKETLLGPGVT
SVDPAAPNVQVTRMALLCESSPRPLILDLQGDLEALKKQAFVLKEGVEYKIKISFRVNRE
IVSGLKYVQQTYRKGLRIDKSDYMVGSYGPRDCEYDFVTSMEEAPTGLMARGQYAIKSKF
TDDDKHDHLSWEWNLNIKKDWTD
Download sequence
Identical sequences Q4RZP8
ENSTNIP00000017145 ENSTNIP00000017145 99883.ENSTNIP00000017145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]