SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017148 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017148
Domain Number 1 Region: 39-138
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-23
Family Ankyrin repeat 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017148   Gene: ENSTNIG00000014138   Transcript: ENSTNIT00000017364
Sequence length 157
Comment pep:known_by_projection chromosome:TETRAODON8:18:1474581:1475717:-1 gene:ENSTNIG00000014138 transcript:ENSTNIT00000017364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTKPYSQDCDLLSSFKHSAAPKSVRSVHFPNDVVFQDYVRHGELERIGRFIRARRVSLD
TIYLSGMAAIHEAVLSGNLDCVQLLVQHGADIHQRDEEGWTPLHMACSDGFPHIARYLLS
LGADPELENDCAEKPADLIEPDNKELLQLFGLLVVND
Download sequence
Identical sequences H3D9F7
ENSTNIP00000017148 99883.ENSTNIP00000017148 ENSTNIP00000017148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]