SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017204 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017204
Domain Number 1 Region: 2-294
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.68e-56
Family Rhodopsin-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017204   Gene: ENSTNIG00000014192   Transcript: ENSTNIT00000017420
Sequence length 295
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:3123498:3129467:-1 gene:ENSTNIG00000014192 transcript:ENSTNIT00000017420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPLFFCLIMLVGLVGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLY
PLPGWIFGNFMCKFVAFLQQLKLLAVTLICMQSITPRPLSLFPLCSCEKMTPRVAMIVSV
CIWIGSFVLSTPVLVYQRLEVGYWYGPRQYCMERFPSKTHERAFILYQFIAAYLLPVLTI
SFCYSLMVKRVGQPTVEPVDNNYQVNLLSERTISIRSKVSKMVIVIVLLFAICWGPIQIL
VLFQSFSTNYQPNYTTYKIKTWANCMSYANSSVNPIVYGFMGATFQKSFRKTFPF
Download sequence
Identical sequences H3D9L3
ENSTNIP00000017204 99883.ENSTNIP00000017204 ENSTNIP00000017204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]