SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017214 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017214
Domain Number 1 Region: 36-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-56
Family Ankyrin repeat 0.0000641
Further Details:      
 
Domain Number 2 Region: 542-734
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.27e-52
Family Hect, E3 ligase catalytic domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017214   Gene: ENSTNIG00000014201   Transcript: ENSTNIT00000017430
Sequence length 734
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:94206559:94213025:-1 gene:ENSTNIG00000014201 transcript:ENSTNIT00000017430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAMEQFNVQLSRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLLNSKFD
VNYAFGRVKRSLLHIAANCGSVECLVLLLRRGANPNYQDISGCTPLHLAARNGQKKCMGR
LLEYNADVNICNNEGLTAIHWLAVNGRTELLHDLVQHVSNVDVEDAMGQTALHVACQNGH
KTTVLCLLDSGADINRPNVSGATPLYFACSHGQRDTAQILLSRGAKYLADKNGITPLDLC
VQGGYGETCEILIQHHGRLFQTLIQMTQSEDIKENMLRQVLEHVSQQSHSHYQRILTSLA
EVATTNGHKLLSLSSSYEAQMKSLLRIVRIFCHVFHLGPSSPNNDMGYNGNKTARNQVFK
TAQPLELLWHSLDEWLVLISTELDRDQENPSSSSPSRSSSSEIASLLLKQREADQSGKLP
LLLDPHIVMETEAYADVEDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFVCRHD
EVLKCFVTRNPKIIFNHFHFLLECPELMSRFMHIIKGQPFKDRCEWFYEHLLASQPDSDM
VHRPVNENDILLIHRESIFRSSCEMVSKSTNEKLKQGIAVRFHGEEGMGQGVVREWFDIL
SNEIINPDYALFTQSADGWTTFQPNSNSSVNPDHLNYFRFAGQILGLALYHRQLVNIYFT
RSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEEVPL
KPGGTSILVTQDNK
Download sequence
Identical sequences H3D9M3
99883.ENSTNIP00000017214 ENSTNIP00000017214 ENSTNIP00000017214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]