SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017223 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017223
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily UBC-like 6.61e-52
Family UBC-related 0.000000147
Further Details:      
 
Domain Number 2 Region: 157-198
Classification Level Classification E-value
Superfamily UBA-like 5.39e-22
Family UBA domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017223   Gene: ENSTNIG00000014209   Transcript: ENSTNIT00000017439
Sequence length 200
Comment pep:known_by_projection chromosome:TETRAODON8:1:328083:331024:-1 gene:ENSTNIG00000014209 transcript:ENSTNIT00000017439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSSPEYTRKIDKLCAMGFEKNAVI
VALSSKSWDVETATELLLSN
Download sequence
Identical sequences H3D9N2
99883.ENSTNIP00000017223 ENSTNIP00000017223 ENSTNIP00000017223 XP_015235764.1.42780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]