SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017227 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017227
Domain Number 1 Region: 182-308
Classification Level Classification E-value
Superfamily Second domain of FERM 4.04e-28
Family Second domain of FERM 0.003
Further Details:      
 
Domain Number 2 Region: 311-412
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-20
Family Third domain of FERM 0.012
Further Details:      
 
Domain Number 3 Region: 94-175
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000117
Family First domain of FERM 0.055
Further Details:      
 
Domain Number 4 Region: 1-34
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000246
Family PDZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017227   Gene: ENSTNIG00000014214   Transcript: ENSTNIT00000017444
Sequence length 975
Comment pep:known_by_projection chromosome:TETRAODON8:1:352753:359926:-1 gene:ENSTNIG00000014214 transcript:ENSTNIT00000017444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPADGILFPGDQVLQINDTVLEDLSKEQVENILSPEICAEEISADVLVLQNPKSSIMSA
EKRARLRSNPVKVRFAEEVVVNGHTQGNSLLFLPNVLKVYLENGQTKAFKFDNTTTVKDI
VLTLKDKLSIRAIEYFALVLEQQYSITKLLLLHEDELIQKVVQKKDSHDYRCLFRVSFIP
RDPADLLQDDRTAFEYLFLQSVGDVLQERFAVEMKCNTALRLAALHMHERLDSCGHTRTS
IKSITKEFGLESFISPTLLSNMREKDLRKAISYHLKKIQSLLEPRQKVISATQARLAYLT
QLGELISYGGRSYTATMMLQDREVLVSLLVGAKYGMSQVINHKLNVISTLVEFSSISRVE
LLSESDKVSLLRISLHDMKPFALLMDSLAAKDLGCLLGGYYKLLVDPTVSVFRLGRPKVR
VHRIPAEEGVCGRFSVIEGVCYESLSSVGCLESKETGRAGSGSDLRTSSSSLGGRLPASS
LRGRIQALPWYMTRSQEILGNLDYPSSSSINGDTSGFGSGLSVASGLSDLNKTPVKEKEN
ANFKSGAKGSFFEDGAEVVIATIKDAEEVTTYMKKANGTNSSHLNLSSRENHVVHRGSVS
SEQPQSRPHSAVGLGGVCSTQVGGDSPTSSYADSTPPQQHREACGCRTVYANCFSGDTED
SISFDEELTVYEFSRRTNPKPARPVPASSPTTPCPNPNLLSLLRDNPRPLSTFSTASSEI
SPLVSCPVSPTSSGGCPLRSLTNKNYGGLKGGFASLRQDIDHLLLVLEKGFLEQPQESRQ
GITDLNHNGMEETTNQALNLNCTGTSTAAMTEAERTLLQAEARRLASGCQRATRVGWAPD
EALRSLSNSFNALVQLSKACLRRNSCTGCGVCQNTGAALRADDEDRQEPMDKLKEIVGLY
KEFVGAVEAAGTGARFGAKASGQTGSGQGEGESDGVRLLAKHCNVLISSVFALTQLFRTC
TLSTTDTPGHVPLNF
Download sequence
Identical sequences Q4RZB9
99883.ENSTNIP00000017227 ENSTNIP00000017227 ENSTNIP00000017227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]