SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017286 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017286
Domain Number 1 Region: 709-923
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.43e-107
Family Thrombospondin C-terminal domain 0.0000000945
Further Details:      
 
Domain Number 2 Region: 601-707
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.59e-26
Family TSP type-3 repeat 0.0000294
Further Details:      
 
Domain Number 3 Region: 532-603
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000379
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 213-256
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.000000000000017
Family Assembly domain of cartilage oligomeric matrix protein 0.0016
Further Details:      
 
Domain Number 5 Region: 462-544
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000124
Family TSP type-3 repeat 0.00011
Further Details:      
 
Domain Number 6 Region: 51-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000791
Family Laminin G-like module 0.058
Further Details:      
 
Domain Number 7 Region: 315-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017286
Domain Number - Region: 369-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 430-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 286-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0086
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017286   Gene: ENSTNIG00000014272   Transcript: ENSTNIT00000017504
Sequence length 940
Comment pep:known_by_projection chromosome:TETRAODON8:4:7056037:7062609:1 gene:ENSTNIG00000014272 transcript:ENSTNIT00000017504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHSVSPVNIQILSLLFSKWILSSPSTVYDLLTSPDCLPDLLQGGLVEQGVNEAFILTSFK
LQPKTGTSVFGLYNPRDNSKYFEFTVMGKLNRAVLRYLRSDKRMSSVTFNNLVLADGQQH
RLLFHLKGMQQQGPGGVELHLDCRLVETVRDLPAAFQGLPAGYGLVELRTMQSRDQDSLD
ELKLLVGDSFENVASLQGCHFQQKDSVQTLGVNTKQLSNQMLELTKVINELKDVLIQQVK
ETSFLRNTISECQACGTLSSQWRHNERLNIRLAPKGLGGTEVVKPKCVPGACFREDLCIE
TAQGVECGPCPDGYTGDGFNCDDVDECQFNPCFPGVKCVNTAPGYRCEACPLGYSGLPVE
GVGAAFAQTNKQICDDIDECDRPDNGGCTANSLCHNSVGSYHCGSCKTGFTGDQGKGCKP
EISCGNSLTNPCDVNAQCIAERDGSITCQCGIGWAGNGYLCGKDTDIDGYPDEKLKCKDP
SCKKDNCIYVPNSGQEDADRDGQGDTCDEDADGDGIPNEQDNCLLKPNLDQKNSDKDNHG
DACDNCRLVENPDQRDTDGDSKGDACDDDMDGDGLKNFLDNCQRVQNPDQQDRDGDGVGD
ACDSCPDIPNPNQSDIDNDLVGDSCDTNQDSDGDGHQDTKDNCPLVINSSQRIPDVLPPG
PDNCRLVPNPDQTDDNKDGVGDICESDFDQDKVIDRIDSCPENAEVTLTDFRAYQTVVLD
PEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSTTGPGEHLRNSLWHTGDT
NDQVRLLWKDPRNVGWKDKVSYRWYLQHRPQIGYIRARFYEGTELVADSGIIIDTTMRGG
RLGVFCFSQENIIWSNLKYRCNDIIPEDFQEFSSQHGGDS
Download sequence
Identical sequences H3D9U5
ENSTNIP00000017286 99883.ENSTNIP00000017286 ENSTNIP00000017286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]