SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017334 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017334
Domain Number 1 Region: 296-467,496-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-19
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 2 Region: 112-220
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000126
Family Cadherin 0.0055
Further Details:      
 
Domain Number 3 Region: 3-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017334   Gene: ENSTNIG00000014318   Transcript: ENSTNIT00000017552
Sequence length 940
Comment pep:known_by_projection chromosome:TETRAODON8:16:7430666:7497319:-1 gene:ENSTNIG00000014318 transcript:ENSTNIT00000017552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWIETSYHGVITENTEVVLLDPPLVALDKDAPIPYAGEICAFNIQGLESPFEAVV
LNGTSGEGQLRARGLVDCEAQKEYTFIIQAHDCGSGPGGAEGKKSHKAAVHIQVNDVNEF
APVFRESEYRASVIEGKIYDNILQVEATDQDCSPQYSQICNYQITTARTPFAIDRNGNIR
NTEKLSYDRQQQYEIQVTAWDCGQKRALQSVPVRIDVKPVCKPGWQEDRNKHMDYEPGTG
SKQLFPKMHLETCGGPLSSARTTVELQTSHIGKGCDRETYSEKSLQKLCGASSGSTDLLP
APSTATNWTASLVTDSGRDSELIFRFDGRQAAKIPDWVVPQNLTDHFTIATWMKHGPSPG
LRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQVDTFRPAEFHWKLEQICDK
EWHYVINVEFPVVTLYVDGVTYDPYLVTDDWPIHPSQIDVQLTVGACWQDFSFAPELRCT
RQLTAWCVGGEVKKPRFTQYFRGSLSGLTIRPGKIESQKVISCLQACKEGLDINSLESLD
KSIKFHFNPAQSILVMEGEDLDNMNTAMRKVSYINSRQFPTPGARRLRISTSVQCFGEDT
CITIPDIDAVVMVLQPSEPRITISGADRLIRPESDFRASDGIALFQDLHIVSTVTRADAA
ARHTARQPEVLEEIIHNLDYCDILVLGEELRPEEESLQVEGGALLGKHLDATNSTSGVSV
YGVDSMSSYEQVIRQVRYQHWQPTQLAERRFQLTCSELNGRYTSNEFKLEVSVLRGSDPG
EHISHIVAPPQYMQVRRPSMLHDLYPSHSSAAVPSAATVVIVMCIAALVVVVVLGIYRIH
LTHQQEVKLEETAKEAGTSWDDSALTITVNPMENLQEPQAEEEADDEITSAESDDSEEEV
DIQLPKVERQSRKGQSWGQISSTSAQKQQRVDWSDWDGSS
Download sequence
Identical sequences H3D9Z3
ENSTNIP00000017334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]