SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017362 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017362
Domain Number 1 Region: 467-756
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-48
Family Eukaryotic proteases 0.00000537
Further Details:      
 
Domain Number 2 Region: 197-463
Classification Level Classification E-value
Superfamily vWA-like 6.68e-40
Family Integrin A (or I) domain 0.0000396
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 4 Region: 159-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 5 Region: 46-79
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000278
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017362   Gene: ENSTNIG00000014345   Transcript: ENSTNIT00000017580
Sequence length 764
Comment pep:novel chromosome:TETRAODON8:16:7937860:7944564:-1 gene:ENSTNIG00000014345 transcript:ENSTNIT00000017580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGANLGPRICCTQQVLGLQGNSITIHSWVSKRCYGSCSVSQHRREGGLEGSVLSYRCRPG
QYPHPVSHRLCGADGDWSPMRTSSGRRVSQAACRDILCPAQLQLDNGDIWPRMQWFQVGA
TQSFSCQEGFTLHGSAQRNCTISGQWTGFPPVCDNHADDCSDPGVPPGAQRSPGQFHIGQ
KFTYLCQAGLDLLGSAERVCLESREWSGSMPRCLGRNTYDSPSDVAAAFTGSLAGLMDVL
SPEEKKTEKTSFGRTFNVAKGSRMNVYILLDTSGSITKQDFEISRNATIALIKKLDSYEV
KLKFHVLSFASGVKIIVDIRHAEISGSADDVIWNLMNFDYNSHGRKTGTNLHDALVSVNE
VLSIFKANSVEQKFNETQNIIIIATDGFSNTGANPQIALAKIRSLLGYHNTSQDQTDVYV
FGIGEQVKKDQLNVLASQKRGEKHVFILKDFETLGEVFNSIISDKSVTMCGVAQEVTQEG
DLEAYTKPWHVTFTSGMSEPCFGSIVSQNWVLTAAHCFARASTDGVSKQFQIKHGAGIAG
PKTVIIHPKYDTRALKQRNVSEFYDYDVALVQVDKRIPLSWTARPICLPCTVPASRAMKK
VNTTCHQHREELLPRLETEAFFIHSHKNPKRRVTHIQTQARRQSCVDKAREVLKEPTDVG
LDEYVTDRFLCSGGSSGYRDAVSCKGDSGGPLFLQQRKRYFQVGVLSWGITDVCNPSNPS
LARGRYSSKNPPPSARDFHIDLFKITPWLKQHLGEEIQFLPDVN
Download sequence
Identical sequences H3DA21
99883.ENSTNIP00000017362 ENSTNIP00000017362 ENSTNIP00000017362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]