SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017377 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017377
Domain Number 1 Region: 948-1237
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.71e-83
Family Complement components 0.0000191
Further Details:      
 
Domain Number 2 Region: 776-896
Classification Level Classification E-value
Superfamily E set domains 1.82e-34
Family SVA-like 0.0097
Further Details:      
 
Domain Number 3 Region: 1317-1433
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.7e-27
Family Alpha-macroglobulin receptor domain 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017377
Domain Number - Region: 349-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0141
Family Invasin/intimin cell-adhesion fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017377   Gene: ENSTNIG00000014360   Transcript: ENSTNIT00000017595
Sequence length 1450
Comment pep:known_by_projection chromosome:TETRAODON8:16:8043702:8051200:-1 gene:ENSTNIG00000014360 transcript:ENSTNIT00000017595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTWSLCVLLSWTLFDHVAADPQYMLAVPAILEAGEESKFCISFLEPNETMTVTVSLKSK
DFNTTLMQMVSKQDFHECRSFEAPSVEKDHVMELEVEVQADTFYSKGARKVLIRQFNPES
FIQTDKPLYLPGQTVQFRVVSLDSKLRPSALKYSVIELKDPSGNRIGQWLNQTTENAILQ
LSHQLNSEAPEGSYEIRTEADGKQALHWFKVEKYVLPKFEVTITSKPEVNIAQEEFEAEV
CAKYTYGQPVAGSATMNVCRGLQRYYFYNPLSVANSPQAELEEPCHKQTKKTDQKGCATF
TFMMSTFTQLDVKALDDQLTMTAHVEEEGTDVKLGNQMTRVISYRLGGLSFINTPTVFKA
GSTVEGTIKAVHHNGTPVANTAVYLFEGEIWSARRLQNLTTDGDGLATFSVSTAARTGDL
KLQASVTPELQYIPYRVPYYENGQHQVSLFQKLSPSGPVISSLEVKAKAGQLPCKQQETF
TITYTVVGEEAGAVDLMYLVLSRGNILRQGSEQFTIEKKLAVNVGEFTFTMMVTTDMAPS
FQVVAYAVLPSQSVIADYADFSTEKCFGHSVSLEFSEGSAVPGEEITMQLDAQPKALCGM
SAVDRSIFVKEPEARLSADTIFRLMPSRRHVPYETEDPQECVPVRLRRSILPFPDGKDPF
TVFQHNGLKMVTNLVIRTPTCLSFKGKHYYSGVGRQYASAPMAGIGFTPQLAYDSAPEIV
SVRTFFPETWLFDLLETGESGQVVKSLKVPDTITTWEADAFCLSSEGFGMAPRVDLTVFQ
PFFLELTLPYSIIRGEQFELKATVFSYLSKCIMLTVTGEESADYKLVPLSGDQYSSCLCG
GERKTVSWNLVASTTGVVEVSVTAAAVASEVSCNNEIVTVPMRGRVDKVTRTLIVKAEGT
EVMEAFNWLFCPKGEELKEESTITLPTNVIMGSARGSVSVLGDIMGRALKNLDGLLRMPY
GCGEQNMALLAPNIYILQYLEKTEQLTPPVKEKALRFLRSGYERQLNYRHYSGAYSTFGA
GVGNIWLTTFVMRSFAKAAEFIYIDQDKMAVTKQWVEGKQQDNGCFEMVGTLFNNRMKGG
VSDEITLTAYITASLLEMNSTVDETVKKSLSCLKTSIEKDGFPNVYTTALMAYAFTLAGD
TETRTRLLNQLNMEAKTKVGGFLYWEQTGENSASLSVEISSYMVLTALSADPSTEDLGYA
SRIVRWLTTQQNYFGGFYSTQDTVVALQALALYSTLVFSPDGSTRVTVASPSASNSFLVT
QDTKLLYQEKELADVEGKHVLEASGTGCAAVQLSVFYNIPAPPEVKTLTLEVSESANCAS
MAARATMNLEIKTGYTGQDNSSNMVILDIKFLSGFAMSRDALERLRGPNNYRVEDKTDRA
LVYIPEIEKDEVITHEVVLIQEHPIIGQKPAVVKLYDYYEPSTKAEKEYTYPCVSGNNRL
KSEHAHGTVK
Download sequence
Identical sequences H3DA36
99883.ENSTNIP00000017377 ENSTNIP00000017377 ENSTNIP00000017377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]