SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017383 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017383
Domain Number 1 Region: 933-1227
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.09e-90
Family Complement components 0.0000294
Further Details:      
 
Domain Number 2 Region: 761-882
Classification Level Classification E-value
Superfamily E set domains 8.54e-34
Family SVA-like 0.0093
Further Details:      
 
Domain Number 3 Region: 1305-1427
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.96e-32
Family Alpha-macroglobulin receptor domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017383
Domain Number - Region: 367-420
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0149
Family Invasin/intimin cell-adhesion fragments 0.0065
Further Details:      
 
Domain Number - Region: 133-191
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.068
Family Ferredoxin reductase FAD-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017383   Gene: ENSTNIG00000014366   Transcript: ENSTNIT00000017601
Sequence length 1431
Comment pep:known_by_projection chromosome:TETRAODON8:16:8111792:8120713:-1 gene:ENSTNIG00000014366 transcript:ENSTNIT00000017601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPVLATLALALAVAVVRSLSAPLNDTKFAVAVSSRLKGGEQETLCAHIQNAAQPVSLS
VSLETDSSSALVLMEDVQQDFYRCMNFQVPLTPSRTVASVNVTVSRGGQTLTKSSKVLIE
PPAFIHLIQTDKPIYKPGQTVQFRIVSTDIDFIPVKRVYTLVELLDPSGNRIAQWLDQVV
VGGILDLKHPMIPEAEQGRYTIGARTDKEEKIQHSFELKEYVLPKYEVKVLLPPVISILD
REATFSVCGKYTYGKPVLGSAKAVVCRKAFSFYWISSEKQPDLCQTFQLTTDKSGCASQT
INVGGFAPNKHTYVDRFEVSAELEESGTGVVLTGAGQTSFSSQVRAVTFKDTPESYRPGL
PFQGKVRMVGPDGKPVAGEPVYVSAGDSQSQTLTTDAKGTATFSFDTALWTGTLTLQARS
RKEEREPYVPDLRQPEYRSTTLRVAAFYSKSRSFLKLLQANGRLPCNKEAAVKVQYLLQG
EELKGQEQLDCFYLVTSKGRIVQHGRVLVAVKAGIVNTGEISVPLRQVGSLAPVAQVVVY
AEMPGGEVVADSQDYPVQLCLNNKVSLKFSSPQELPAEKTTLSLKAHPGSVCSVRAVDQS
VLLLQAEEELSVASVTVPSVPAPPGAFARNDPQRPPEERLFFFSHQEIGMKFVTNGDVKK
PYDCLERFPIYAFYDADMVDAPVPLAFNTMVERGEVLRKDEQKKETLRTFFPETWIWDLV
SVGDAGSVDLDKTVPDTITKWAAGAFCVSSAGLGVAPGAALTAFQPFFVSLTLPYSVVRG
EVFPLRATVFNYLSDCIMVQLTLAESDQYAFRSCDGCRYTACLCGEESATFTWIVTPAAL
GIPVKLKVSAEALKTDVLCGNEVATVPKTGQIDTVVRTLLVEAEGTPEMVSHNALLCPAE
GPKEKKVSLLLPEFFVAGSARASVSVLGDLMGRAMKNLDQLLAMPYGCGEQNMVLFAPNI
FILNYLQSTGQLTPDIREKATRFLESGYQRELTYKHDDGSYSAFGKSDPSGNTWLTAFVM
KSFGGARPFIFVDPKHIKDARRWLAEHQRPDGCIRSVGKLFHNGMKGGVSDDVSLTAYVA
AAMLELEADLEEPVVQKCLECLRAAVSGQLDNLYTSALLSYTFTLAKDEETRSKLLADLH
QKSSDNGGTRHWDRAGASGRGLDSLEVEMTSYVLLALLSGPALPGFGLDYASGIVRWLAR
QQNPYGGFSSTQDTVVALQALAKYGAATYSPEGSTTVTVTSLGGLRKEFTVDQSNRLLYQ
EEKLSEVPGEYAIRAEGRSCVLAQISAHYNVPPPPGFSAFNVTASTTAKCGARRPQLLLV
LDVGYRGRREETNMVIVNVKLLSGYVLEPSSLDLLKRDTSVKRVDLEDGYVNVYLDGLKK
AETKTYSLTLEEELPVRNLKPAVVKVYDYYQTGDVAATEYSSPCSEGESRG
Download sequence
Identical sequences H3DA42
ENSTNIP00000017383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]