SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017400 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017400
Domain Number 1 Region: 595-658,829-948
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 2 Region: 6-94,125-201
Classification Level Classification E-value
Superfamily RUN domain-like 3.27e-31
Family RUN domain 0.0019
Further Details:      
 
Domain Number 3 Region: 924-1047
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.36e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017400   Gene: ENSTNIG00000014383   Transcript: ENSTNIT00000017618
Sequence length 1055
Comment pep:known_by_projection chromosome:TETRAODON8:16:8307136:8331049:1 gene:ENSTNIG00000014383 transcript:ENSTNIT00000017618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEEDYKEKLLWNVKREVKQIMEEAVTKKFVHEDSSHIIALCTAIEACLSHLLKRRAAGF
LRSDKIAALFTKVGKVYDTAGEICRKVQDQLQQQADLTRRTQSVGHEPLRRQGSSTTCRP
PQPLSAQAIKHIWVRTALFEKVLDKIVQYIVDNSSKYYEKEALMHDSVFGPILAALLVGP
CALEYTKLKTSDHFWTDPSANELVQRHRIHGAHRSQDTPAGRRPALGIRKRQSSSSMSED
RFAASAREYVESLHQNSRTHLLYGKNNVLVQPKKDMEVLRGYLSLHQAGDNLTLKWTPNQ
LINGTLGDCDLEKSIYWDYALTVPLRQIVCIHCHQRPDSGGTLVLVSQDGIQRPPLHFPP
GGHLLAFLSCLETGLLPRGQLEPPLWSQKGKGKVFPKLRKRSSTARLLDQDSNDEEQTAA
DYVFRIVYPGYRYDAITINYHHTTGSRAPSLDDDEEEEDRLHAMISMICSRNLTDPNVIK
DHGEMMEMQGFGGSPSSWQQADVTAQESLCLSCSTAASNVSMDYPGGCTCIHDHIPLKML
CQNMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVNHNIVPPDRPCEAAGGLSKEVWSKYQ
KDCKNYKQLELLRLVYYGGVQHEIRKEVWPFLLGHYKFGMGKKDMSQIDVKISERYQQVM
REWKACEVIVKQREKEMQSAIFAKLSSGSSIDSHVLRLVHRDSTLSNEVFMSVDEPETGG
QETPGGWDGTPTMTTLVPPAALPQEDRPLVEFDSPDSGLPSSRNYSVTSAHSQNLSSIDD
GQSTEEEGAGGEDARTPGAPAGRQDSLSEDRLCSQLDKLATGGASPSLSSYTIELLDTVA
LNLHRIDKDVQRCDRNYYYFTTANLEKLRNIMCSYVWEHLEMGYVQGMCDLLAPLMVILD
DECLAYSCFTQLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMQQNGDYTHFYFC
YRWFLLDFKRELLYEDVFAVWEVIWVASRISSRHFVLFLALALVTVYREIIIDNNMDFTD
IIKFFNEMAERHDVQNILKIARELVHKVQSLMDNK
Download sequence
Identical sequences H3DA59
ENSTNIP00000017400 99883.ENSTNIP00000017400 ENSTNIP00000017400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]