SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017427 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017427
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.25e-19
Family PB1 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 215-262
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000895
Family ZZ domain 0.018
Further Details:      
 
Domain Number 3 Region: 928-965
Classification Level Classification E-value
Superfamily UBA-like 0.000000204
Family UBA domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017427   Gene: ENSTNIG00000014410   Transcript: ENSTNIT00000017647
Sequence length 976
Comment pep:known_by_projection chromosome:TETRAODON8:2:1352825:1358978:1 gene:ENSTNIG00000014410 transcript:ENSTNIT00000017647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPVTIKVNFRGNVKRFLAQDLDKLEWESVEAWIKASFGINHFQVKYFDEDNEEICINS
QDEYEEAIKSAEKQGNQLHMNVYKMKGQACGGPLKTEVKELKGDLRPAPPYPSRVKTVDK
GTQVTPEREAVAVKDARGGKPEDEPPPMWFRSYMEKFKDEVVKEVVERMCSDFSGQCCTH
KSPEGNGEASGAAGGVLGPLPGPSASNGSLGYTPNCSSCHKLTSDGAYKCSVCPSCILCE
TCRHSHDPSHSLVRTKTPLSIPEHGMSGEEAGLCSADRFARRGDRTVRKAERQRLKAERR
QLRAEVKEIKKKLRLEKRGLQWSGPSTSGSGPAPLYRLRQSLRSKPGPFSTMLCTLETRG
PGVWHGSLVPTMAALFLDENLPDGTRLEPGTKFIKYWKMRNSGTVSWTSETKLTFMWGNL
GRACEDRREVPVPLLLPGQVGVVSVAFVAPGLEGTYTSHWRLAHCGCQFGPRVWCSIVVE
PRAPEQTTGKSATLLRPQQVNSNKKEEAGSLVKEKVSILDLSVDLNQDDLCFPSVELLTA
QDLLSFELLDINIVQELEKVPTNTPVDVTPCMSPLPHNPAWSSPLRDQADVPGAPSLFGL
KLGQQKEPQEPALLPEEEREEEMSGAQFLCETVMRSLTLEEAPDHRPPRRAQPRCSRQGD
ERPPPLPEPAGFHGDALTPSMFVSHLPVAPTAAAQEGNQEKPESSAPREEEEGSPGEVSS
QASSVSSCDDYIILPDCFDTSRPLGESAHHRGGERLDPSGGAESSWPPPGPQTLDPVTLA
PEAPPPSPLPPPPALYSPRPRSGNPAAEPQLPPVLRVQACEICCCGFCPVSSGLSPSAGS
ASSAFETYTPRPGHALQPRCNRGARARRRPPLPALTPPVRVVSRGQGGITEGLVKGALSV
AASAYKALFTGPNCSVQRGIDPGARQDPSMMAMLLEMGFRDQRLNQQLLKKHSYSLLHTV
NELVQMAEDSWGQRRP
Download sequence
Identical sequences H3DA86
ENSTNIP00000017427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]