SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017432 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017432
Domain Number 1 Region: 57-443
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.19e-132
Family Ankyrin repeat 0.000000000335
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000199
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017432   Gene: ENSTNIG00000014414   Transcript: ENSTNIT00000017652
Sequence length 1073
Comment pep:known_by_projection chromosome:TETRAODON8:2:1309301:1326263:1 gene:ENSTNIG00000014414 transcript:ENSTNIT00000017652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTALQSGLTPI
HVAAFMGHDNIVHQLISHGASPNTSNVRGETALHMAARAGQSNVVRYLIQNGARVDARAK
DDQTPLHISSRLGKQDIVQQLLANGASPDATTSSGYTPLHLAAREGHRDVAAVLDNGADL
SVVTKKGFTPLHVAAKYGNMEVANLLLQKNACPDAAGKSGLTPLHVAAHYDNQKVALLLL
NQGASPHVAAKNGYTPLHIAAKKNQMEITTTLLEYGAPTNTVTRQGITPLHLAAQEGNID
VVTLLLARDAPVNVGNKSGLTPLHLAAQEDKVNVAEILVNHGATLDPETKLGYTPLHVAC
HYGNVKMVNFLLKNQAKVNAKTKNGYTPLHQASQQGHTHVINLLLHHGASPNELTNNGNS
ALSIARRLGYISVVDTLKAISEETLTTRTVIEKHKMNVPETMNEVLDMSDDDGQGDDAMT
GDTDKYLAPQDLRELGDDSLPQEGYMGFSVGARSQSSDRSNTLNRSSFTRDSMMIEEILA
PSKDTLLAVARNDNDSLRRYSWTPEALDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHN
GMRIIIPPRKCTAPTRITCRLAKRHKLATPPPMVEGEGLASRLVEVGPAGAQFLGPVIVE
IPHFGSMRGQERELIILRSENGESWKEHLYDCKTDNLVQLLAGMDEELDSPEELERKRIC
RIITKDFPQYFAVVSRIRQETNQMGPEGGTLRSRSVALVQASFPEGALTKKIKVGLQAQP
VPEDTVKKILGNRATFSPIVTVEPRRRKFHKPITMTIPVPPLSGEGLTNGYKGDSTPCLR
LLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLADCHQIPETVGLATQLYR
ELICVPYMAKFVVFAKMNDHVESRLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGR
PIYVDCYGNLTPLTKTGQQLILNFYAFKENRLPFCVKVRDPSQEACGRLTFLKECKPTKG
LPQTAVCNLNITLPSARKTEKPERRHTFASLALRKRYSYLAEPALSEFDIFTN
Download sequence
Identical sequences H3DA91
ENSTNIP00000017432 ENSTNIP00000017432 99883.ENSTNIP00000017432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]