SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017438 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017438
Domain Number 1 Region: 12-184
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-40
Family RUN domain 0.0013
Further Details:      
 
Domain Number 2 Region: 550-651
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-16
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 
Domain Number 3 Region: 711-817
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000308
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017438
Domain Number - Region: 858-909
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0293
Family Di-heme elbow motif 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017438   Gene: ENSTNIG00000014420   Transcript: ENSTNIT00000017658
Sequence length 1091
Comment pep:known_by_projection chromosome:TETRAODON8:2:1231049:1236501:1 gene:ENSTNIG00000014420 transcript:ENSTNIT00000017658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQSPDAPVEPRYVQQIKEKLAQSLKALQKRYVTLDVVVTSEDGDANALCCALEAIFIHGI
RSKYISSNAGSRSRRGDREPVPQPFFWRLLKSVTHRDVISELEKISFVSTDVGRCRAWLR
LALNHGLLECYLASLFREDSKLRAHYQHGALLLNAEEREVLLSYLQGLASLTFNLSYKSA
VLNEWTTTPLALAGLCPMFQTETHDPLLNGGGLPPSHPTNKELWDTESQSSSSSDAPDVQ
KRCPVLTERASGGLRGCASGLNTSSLSLDTTGSSQLSSSLSSDSLLQGQEPRSPAGEHWS
SCDLDINVSGSRPPKDVLNEFQESSQCSQDSMREDSFVSSTGPDQYSETAIFSCSDSETQ
SPPTPPQDQPQRPDPEVAPTPPEQPASSEEEVEENPAEEPAEECEAGQVLEEAESGHDAH
RDVQRSASVLSKTSLDSLPVSMFLESVTHSATEKSWKIDSSCREPAEKKKIEKSPLMSHS
LFPKTVNGSGIQNSAIGQHSRSWISEDDIHKPHRATVLDHNQAPAPAPSAEPKATQSPPS
VVHRRQIGLANPFRGLLKLGHLERRSAVGLWRDYYCELSPFEFRLYLDAEERSCYDNCSL
VRCEGARITSPDGRFDLVFPGKRLSLRAANRDEAEDWIDRIVEAIHKCRPAFRIDDQWEV
LQPCSEAGAEASPPVSASSGPEQIPAPVLGTCGGQEKPPPAEYRWTRTADVETDAIKEGV
LYLSTDPEARTWVPLVFSLLEAVKGFQVEEGKKMLRRTLPVQEVRDVVPDVSLGGPEFFK
LLTLRETLRLRAENGEEARSWRALIRGALDSYLESGEDSAPAAGMGWSGSGNLQRLVQHR
LKEDGALCVHLCTVPSERGLDAQNFKCAGCPQRIGPSLSRARLCHFSGQYYCQSCHRGDT
TIIPSRMVHNWDLSQREVCTKALWLLAQVEQEPLFNLEQLNPELVKHSEPMAQTHRLRQK
LRLLGDYLLSCRSGACRNYKPRMEQRTYLLEFSHLYSVLDLRQIAEGQYATYLITLMQYA
SKHVYQCDLCTQRGFICQICRADDIIFPFQFDSTTRCKDCKTVFHLTCKSPRDPCPRCQR
MRRYMERDLQD
Download sequence
Identical sequences H3DA97
ENSTNIP00000017438 99883.ENSTNIP00000017438 ENSTNIP00000017438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]