SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017446 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017446
Domain Number 1 Region: 7-458
Classification Level Classification E-value
Superfamily Sema domain 2.75e-155
Family Sema domain 0.00000000476
Further Details:      
 
Domain Number 2 Region: 461-499
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000227
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 519-606
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000163
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017446   Gene: ENSTNIG00000014428   Transcript: ENSTNIT00000017666
Sequence length 805
Comment pep:known_by_projection chromosome:TETRAODON8:2:1152168:1162110:1 gene:ENSTNIG00000014428 transcript:ENSTNIT00000017666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGSSRFVGSSLNYSTLLLEEGSGLLYVGGRGVLYALNTTNISTAAGLRIDWDASPEQKK
LCLNKGRDNQTECYNHIRFLQRYNESHLYTCGTNAFRPLCAYIDAERFSLVSGFEEGRDR
CPYDPAKGYTGLLVDGEMFTATQYEFRSSPDVRRNFPFPTLRTEEAPTQWLLEADFVGSV
LLKESINSSIGDDDKIYFFFTERSQEQVVYPSQTKVSRIARVCKNDWGGQRTLQKKWTSF
LKARMMCSVPEYELHLNILRSVFVLQGRDARNSIFYGIFGLEWKNIKASAICQYAFSDVQ
KVFDGPYMEVQDSKWREYTGRVPEPRPGSCITDVHRSQNINTSRDLPDNVLTFARRHPLM
ARQVHPIGLRPLMFKRSVNYVKIAVHQEPALDGILYTVLFLGTDDGWLHRAVDIRGEMHI
MEELQLFEKAQPVQALVISSALRSIYVSSSSGLVQVPMAACQRYASCYDCVFARDPFCGW
DGKACVELASRAQRSNLTQDVLRGIRGCRENSGNVTHRKRSVMAGDDVLLQCELRSNLAS
PRWTLNGRELMGYGLNSGYRIGTDGLLIIGARAQQSGTYRCFAVENSVSVLVFLYSVRVH
TDPPLPSPPAPLPPEFQTYRHMEAVYISLVAVLGGLCLVLTVVLLYMSFCTRLAARGRKS
SQQGLQVLGASERKRSSHFELKTISSHCNGRQDRRSISVPTFGAMGDGFLQMVPGECQLS
PAKTPPPAPPLPMPPPLPNMDYANGLSATLPSVLRKMNGNSYVLLRQADSEGMSPLYHSF
TEELNRILEKRKHTQLSLQPDESSI
Download sequence
Identical sequences H3DAA5
99883.ENSTNIP00000017446 ENSTNIP00000000675 ENSTNIP00000017446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]