SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017452 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017452
Domain Number 1 Region: 807-1156
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-76
Family Ankyrin repeat 0.0000119
Further Details:      
 
Domain Number 2 Region: 1182-1305
Classification Level Classification E-value
Superfamily TPR-like 3.8e-21
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 3 Region: 240-322,418-499
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000103
Family Extended AAA-ATPase domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017452   Gene: ENSTNIG00000014434   Transcript: ENSTNIT00000017672
Sequence length 1756
Comment pep:known_by_projection chromosome:TETRAODON8:2:984554:1014322:-1 gene:ENSTNIG00000014434 transcript:ENSTNIT00000017672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSVDEAANTLMTRLGFLLGDKVVELTLIKIFLCNYCFKSCQGQNQRISPCSTLTSSTASP
PAGSPCSTLPPTMPGQTGNKDCAYGSVTSPTSTLESRDSGIIATLTSYSENMERGGKYGE
GSRGNLKQWHSQKSGMDSFLYRVDENMTASTYSLNKIPERNLESMSSHSAHSIPLYLMPR
PNSVAVVRLQKPATSSAHLEDLAYLDEQRHTPLRTSLRMPRHNLTGFPSPDPPVRFAPYR
PQDIALKPLLFEVPSITMDSVFTGRDWLFQEIDGHLNQPSSSTSRGVAVVGNIGFGKTAI
VSRLVALSCHGTRMRQIASDSPQASPKHGEGFPLSQPQTAHGTLGGGSCPGTPEMRRRQE
EAMRRLASQVVAYHYCQADNAYTCLVPEFVHNVAALLCRSPHLVAYREQLLREPHLQSIL
SLRSCVQDPLASFRRGVLEPLDALYKERKIISEEDLIILIDGLNEAEFHKPDYGDTIVSF
LTKTISRFPPWLKLVVTVRTTLQDITSDLPFHRISLDGLEENDAIDQDLQGYILHRIHSS
PEIQNNISLNGKMDNTTFGKLSAHLKALSQGSYLYLKLTFDLIEKGYLVLKSSSYKVVPV
NLAEVYLLQCNMRFPTQSSFERALPLLNVAVASLHPLTDEQIYQAINAGSLQGTLDWEDF
QQRVDNLSVFLVRRRDGTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQE
KLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLWVSYCTEGLSAALSSLRNLYTPN
IKVSRLLMLGGANVNYRTEVLNNAPILCVHSHLGYMEMVSLLLEFGASVDAPSESGLTPL
CYAAAGGHMAIVSALCRRRAKVDHLDKNRQCALVHAALRGHMEVVKFLIQCDWAPGQQQQ
QQSPQSQQQAALTKSHAVQQALIAAASMGYTEIVSYLLDLPEKDEEEVERAQINNFDTLW
GETALTAASGRGKLEVCRLLLEQGAAVAQPNRRGIVPLFSAVRQGHWQIVDLLLTHGADV
NMADKQGRSPLMMAASEGHLETVEFLLAQGASLPLMDKEGLTALSWACLKGHLPVVRYLV
ESGAAPDHADKNGRTPLDLAAFYGDSEVVQFLVDHGAMIEHVDYSGMRPLDRAVGCRNTS
VVVALLKKGAKIGPATWAMATSKPDIMIILLSKLIEEGDGFYKQKGKVKEAAQRYQYALK
KFPREGFSEDLKTFRELKVSLFLNLSRCRRKMNDFGMAEEFATKALELKPKSFEAYYARA
RAKRSSRQFTEALEDLKEAMKHSPNNREIQRLLQRVEEECHQFSQQEHQQQGLELEPPPS
PPPTPPPEEEESLSLPMPLPPPPEPRLEDMEPVQDLFEDEDYLEQELEAMAVGLPPPESL
SDPSSLPIIQSQQLPGRPKSPLSKMSSQRSFQHHQAQGLRLQPSIAQIVRTNQPSVMGNS
IYAGQMGHSMGGRYQGGSVDVESRLVYQPSLDGRSMSQVQASLSSGALCQHGGRGGVMDQ
TPQISRSQSAAYYPVSEHVLERTGVVPTCQLGSPEIPHMARRPVSANTTEMKQHVSAPRP
LIHSQSVGLRFSPSSNNISTGSTTNLAAYEHACDDISPISPSQGGGALYQQGETTRSRNT
PFMGVIDKTARTQQYLHQPSRSRAMTSMDPAISPTSPGQLVQQGSTYSPPASLEEDYYSQ
TPPQSLGKLTNGSRGVGDILERVSQVPTYQDVKVARTLPVAQAYQDNMYRQLSRDARTQG
PTSPIKPKRPFVESNV
Download sequence
Identical sequences H3DAB1
ENSTNIP00000017452 ENSTNIP00000000651 99883.ENSTNIP00000017452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]