SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017490 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017490
Domain Number 1 Region: 257-509
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.85e-39
Family Diacylglycerol kinase-like 0.0067
Further Details:      
 
Domain Number 2 Region: 740-830
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000213
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017490   Gene: ENSTNIG00000014470   Transcript: ENSTNIT00000017710
Sequence length 841
Comment pep:known_by_projection chromosome:TETRAODON8:3:7562984:7601493:1 gene:ENSTNIG00000014470 transcript:ENSTNIT00000017710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KETSSENESAVYGDHIWFETNVSGDYCYVGEQHCIARALQKSVSRKKCAACKIVAHTICI
EQLEKINFRCKPSFRESSSRNVREPIMVRHHWVHRRRQEGKCKQCGKGFQQKFTFHSKEI
VAISCSWCKQAYHNKMSCFMLQQIEEPCPIGAHAALVVPPTWIIRVRRHQSSMKSSKKKK
RTSFKRKSSKKGAEIEEKQQPFVDKLCISVLLRPPQTNCNVPPDGAQGTLVSQIRIWVSS
XCPSFSLKLYRKVHNLRILACGGDGTVGWILSCLDELALNPQPPVAVLPLGTGNDLARTL
NWGGGYTDEPLSKILSHVEEGTVVQLDRWSLRVESNHTAGVEPDEQQNDKLPLDVFNNYF
SLGFDAHVTLEFHESRVEANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLSKHIKVVCDG
TDLTSKVQDLKLQCLVFLNIPRYCAGTTPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLA
TLQVGGHGERLSQCREVTLTTTKPLPVQVQAVITLVAHPAYIQSCLTSLAYYFVKVKIKL
INPLAQSPNQVQNYDRLDSNRISLNERFGINESRVVLFNGQLAWTASGSCLYCFCTIPLG
LIVVPGDSDLETCREHIQRLQEEEQQSTFSVKGSDTVSLQHEEAAKSKPFSFQRLSPKWC
FLDSTTADRFYRIDRAQEHLNYVSEISQEEIFILDPELVVMTTVGTSPSAMPDLVTPTSS
PVNSSQHALLIVLTKIQFLCCIELHTKGADLTILDGSGYSLLHHAVHTGCKEMVRYILDN
APSDLLDVTDHLKCAGATSGETVLHRAASLCHRTICHYLVEAGASLMKTDMQVAPNPENR
A
Download sequence
Identical sequences H3DAE9
99883.ENSTNIP00000017490 ENSTNIP00000017490 ENSTNIP00000017490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]