SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017494 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017494
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.12e-24
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017494   Gene: ENSTNIG00000014473   Transcript: ENSTNIT00000017714
Sequence length 159
Comment pep:known_by_projection chromosome:TETRAODON8:3:7528200:7529953:-1 gene:ENSTNIG00000014473 transcript:ENSTNIT00000017714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLLSCGMQLECLMRLVQMGCEVNTATSHFKHTPTHSAAMGGHADCLVWLTQAGADINRQ
DFLGEAPIHKAARSGSLECTQVLLIGGAKPSLQNTSGQTAADLAYAHGFHHCFHLISKSQ
LRAPSMNEGQNGNGAPCGLDLRSRTSLKIIDAYLFATRC
Download sequence
Identical sequences H3DAF3
ENSTNIP00000017494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]