SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017519 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017519
Domain Number 1 Region: 17-34,258-350
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-18
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017519   Gene: ENSTNIG00000014496   Transcript: ENSTNIT00000017739
Sequence length 365
Comment pep:known_by_projection chromosome:TETRAODON8:3:6978622:6980169:1 gene:ENSTNIG00000014496 transcript:ENSTNIT00000017739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVHPLAMAADGNFGAVEQIVNFLKENGGKVTNMDLIERFKTALPDEPERKAAARLHFKTC
VNSVAFVRPEDGVKYVCLRKKYAKERENSPESGEMAATRSRYSAGVCGSGEADGGAPGSG
YGNMGNRIGFQKERQRVREAPAVPKITVTEASPLPAEGPVFTLEKTKQPDEEDGDGQSLS
CSEGGVSPKSSRHHFLQLMRSSSPQVRRSLVLRSDGDAALLDDDRSAVTLDPLEHEWMLC
ASDGEWSSLQRLLGAEPSLILRKDFITGFTCLHWAAKHGQPELLALIFNFAKRNNVPLSV
DVRSNAGYTPLHVAAMQNHLEVVKLLVGAYNADVEIRDYSGRKACQYLANGVSADIREIL
GARSE
Download sequence
Identical sequences H3DAH8
99883.ENSTNIP00000017519 ENSTNIP00000002927 ENSTNIP00000017519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]