SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017531 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017531
Domain Number 1 Region: 415-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.71e-75
Family Protein kinases, catalytic subunit 0.0000000568
Further Details:      
 
Domain Number 2 Region: 864-1007
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.44e-52
Family FAT domain of focal adhesion kinase 0.000017
Further Details:      
 
Domain Number 3 Region: 141-262
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-40
Family Second domain of FERM 0.0000181
Further Details:      
 
Domain Number 4 Region: 264-368
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-27
Family Third domain of FERM 0.00018
Further Details:      
 
Domain Number 5 Region: 39-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-27
Family First domain of FERM 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017531   Gene: ENSTNIG00000014508   Transcript: ENSTNIT00000017751
Sequence length 1017
Comment pep:known_by_projection chromosome:TETRAODON8:3:6677327:6689276:-1 gene:ENSTNIG00000014508 transcript:ENSTNIT00000017751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDTSTLSWRSVPASSLSASTDVCPKVHPPTKEGTFPVKIIKVCFLSNSSNLGKNFKLV
RSEEGWTVGAVINAVLSSGCVGPDIKFKLSYGLLLKHLKSSENHWLHPDMSISELTQRYE
QQHLEAEWSRYDLRIRYIPSNFMEEFQDDRTTMLYFYLQVRSDYMHQYARKVSDGMALQL
GCLEIRRFYKDMNPRGLEKKSNFELLEKDVGLDMFFPQELISSMKPKQLRRLIQQTFQGY
STLNQEQCMIKFFSTLSQCYSFTQERFACQLAHGWNITIDLVIGSDGISQQNENSSQATH
LATPSQVRSITCSTESDGRALLTVNIEGGKEPLSVYASSLAVAENMADLIDGYCRLEGSS
ETSLIIRPNKGRATRQKLPDIPKWCWMDGISDLFLFPDSDIYCEIIEGKESTGSNEYKIS
RDDIIVGQILGEGFFGEVHNGVYKTQTGENLSVAIKTCKNCSADVKEKFLSEASVMKNLD
HPHIVRLIGVIEADPVWIVMELYEHGELGKYLVEQQYSLTTVMLITYCLQICKALAYLEG
LNVVHRDIAVRNILVASPLCVKLGDFGLSRYIEEEEYYKASASRLPIKWMAPESINFRRF
TTASDVWMFGVCVWEIFSMAQQPFFWLENSQVIDQLESGIRLPKPQLCPPTVYSLVSSCW
SHEPHLRPQFSHLACSLSEIHRMESEQELGARGCRSRPNSAMFDPNSTEAPPKVAHRAHR
RETLTLYTAGQRHINDFFLLSTQALQTPGQYTSTNNSMHSTGVFLPFSLLFTRTKMIFKS
SHTNKHSLPLSWAKDRTVHVEDTLQRQRMEMMMDKKWLEREERQMDPVVRPDSRTETPPL
SPKDRDLSLSGPPEKPPMPATISKLQPRPTAELDRAGDEVYTGVMAMVKQVVQLKNDITT
LPSSEYPNSVKALGVTLRSLIQKVDEILPSLHHSVTTEQIEGTKKLLNKDLGELISKMRL
AQQNTVTSLKEDCQRQMLAAAHTLALDCKNLLDAVDQARVRANLARPRPTSQALDGY
Download sequence
Identical sequences H3DAJ0
ENSTNIP00000017531 ENSTNIP00000017531 99883.ENSTNIP00000017531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]