SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017554 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017554
Domain Number 1 Region: 270-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000588
Further Details:      
 
Domain Number 2 Region: 426-589
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-39
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000231
Further Details:      
 
Domain Number 3 Region: 143-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-35
Family Spermadhesin, CUB domain 0.0000231
Further Details:      
 
Domain Number 4 Region: 642-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-29
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 25-127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000877
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017554   Gene: ENSTNIG00000007570   Transcript: ENSTNIT00000017774
Sequence length 938
Comment pep:known_by_projection chromosome:TETRAODON8:2:17929275:17969902:1 gene:ENSTNIG00000007570 transcript:ENSTNIT00000017774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKLVKLKWYKSMSLFSLSVLPASEPCGGYLDATNAGYITTPGYPLEYPPHQNCRWVITAP
EASQRIVLNFNPHFEIEKLDCRKVQHNVWLCGCVEFADMPGLYCKRFLPPLSSASLFLRY
QTTDSAEGADMSLKHLTKTGSSDCSRNFTSPSGLIESPGFPDKYPHNLECSFIIVVPPSM
DVTLTFLTFDLENDPLPGGDGDCKYDWLEVWDGLPGVGPLIGRYCGTRVPPEIHSSTGIL
SLSFHTDMAVAKDGFSARYNMTHKEVSETFHCSNAFGMESGKITDDQISASSSFYDERWL
PRQARLNFNDNGWTPNEDSNREYIQVDLHTLKVLTGIATQGAISKETQKAYYVTTFKLEV
STNGEDWMVYRHGKNHKVFHANADATEVVLNRIPQPVLARFVRIRPQAWKNGIALRFELY
GCQITDAPCSELQGMLSGLLPDSQISASSMRDIHGNMGAARLVASRSGWFPNPTQPVAGE
EWLQVDLGVPKMVRGIITQGARGLEGSSSAENRAFVRKYKLAHSLNGKDWTYITDSKTSF
AKIFEGNSHYDTPEVRRFEELVAQYIRVFPERWSPAGIGMRVEVLGCELPGFPNTYKRLG
KTVEKPDGVSSFTMSQDAKNEHQQQNAPARDDREQKSYGKENCSCAVCDFEQSLCGWSAD
PLSGNRMMTVSTPPRLNRTVSFSGNYLHLDAGAHIQRKRARLLSPEVGPEQGPLCLVFYY
QLQGEAQGSLRVLLKDSEQEETLLWALKGEQGSHWREGRTILPQSPKEYQVVFEGFFDHP
TRGHIKIDNIHMSSNIQLEECTHIVAKFKVVDFTVSSISGEGFSKCKIDPEMKICWQSSF
STPSTSDVDPPSVTLVSEKDKDNAWLYTLDPILLTIIVMSSLGVLLGAICAGLLLYCTCS
YSGLSSRSSTTLENYNFELYDGIKHKVKINQQRCCSEA
Download sequence
Identical sequences H3DAL3
ENSTNIP00000017554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]