SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017572 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017572
Domain Number 1 Region: 305-431
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-25
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 436-536
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-23
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 71-171
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000697
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 216-299
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000448
Family Ras-binding domain, RBD 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017572   Gene: ENSTNIG00000014547   Transcript: ENSTNIT00000017793
Sequence length 1298
Comment pep:known_by_projection chromosome:TETRAODON8:3:5475772:5487577:1 gene:ENSTNIG00000014547 transcript:ENSTNIT00000017793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRAAPAPLQTRSILPVLKSSALLSHKNKISGWPPPGPGSWGGLQGPPYSWDSMNSSSSSR
EGRDCLTNQVSQSSSLEEVPLDGVPPAPRLVEMRRDPVLGFGFVAGSEKPVVVRSVTPGG
PSEGKLLPGDEIIMINDEAVSSAPRERVIDLVSRSCKESIMLTVVQPYPSPKSAFISAAK
KAMLKSNPVKVRFAEEVIINGQVPNPVKDNSLLFMPNVLKVYLENGQTKSFRFDSSTSIK
DVILTLQEKLSIKCIEHFSLVLEQRMEASGSRVLLLHEQEMLSQVTQRPGSDKMKCFFRV
SFMPRDPMELLRRDAVAFEYLYLQSCNDVVLERFGPELKSNAAMRLALQMYILTMTTRQS
QKVSLKYIQKEWGLPLFLPPAVLSSMKEKNIKKALTHILKTNQNLVPPGKKLTALQAKVH
YLRYLSELKLYGGREFQSVLLQGEKQTDVTLLVGPRYGISHIINPRTNLVALLADFSHVN
RIEILTEDETNVRLELHVLDVRPITLIMDSSDAMNLACLTAGYYRLLVDARRSIFSISQW
NSTGGDDGKTAPDFSILTNTTTNKCFKDQLDQERVLEWPYSTSLGNEEPLSYQEDGYNRD
SEYSDNGRGENSISPYFFEHQNPDRDVGRESPLPPPLPPATRHKPQDSPRSAKVSFIFGG
DPPLNKPRNLVYERLLESPDAPEHRLPYLHNNSNFQQQDRGAFQFSALTHVYSNILTEEG
GDEPLLRDLMYRDTTDDAEDDDDGSGEEDFSGGTAGKATFLALSGTSDDIIDLTSLPPPE
GDHGVDDDEEDMLLQTLNLAIAAPPPGFQDSSDEDAAPEGRPLSTNDNDDIPVSLIDAIP
THGLEEEDKVGERQSGNAVMNSLQVLEAQAISEQRPPLPPPSNSNNPGAYTSRGFSPVSS
SDSGNETNSSEMTEIFELAATHKLNEAHMRLLVATREGYQPLLEEKTEFPVSPSAGGMAP
KKPRSPTRHLQPPAVPPRRSPQLDTAASGPDAVEVRAQTNLSSTLQRPSSTTPGGKHHRK
SADSSGKYNTFSTRDGHRGEYMASRSRLDLDQRTSFSERGESQRRQHPVLLENSEGGCLA
NSVPGDHHRNPYPASSTSDHLLNVSLGTCGADDGATAVEQDEHLVVASLLSPTKKPRVGG
SDQGSDIQSDHPPLSRQHSVARLCEYHLAKRISNLQGEAHSSLQGSLCSSLDAGGSTNSS
TCPTPTDSPLGPGAFESKHHHLQRHPLSNSSSSLLRVLNYEDGKAGRTLPNAQGKDLHPH
ADPALLRKMLPNIHPAVTGPEPGRPSSATPPKHKDNAG
Download sequence
Identical sequences H3DAN0
99883.ENSTNIP00000017572 ENSTNIP00000017572 ENSTNIP00000017572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]