SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017580 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017580
Domain Number 1 Region: 60-335
Classification Level Classification E-value
Superfamily C-type lectin-like 8.67e-103
Family Sulfatase-modifying factor-like 0.00000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017580   Gene: ENSTNIG00000014555   Transcript: ENSTNIT00000017801
Sequence length 341
Comment pep:known_by_projection chromosome:TETRAODON8:11:7689507:7692726:-1 gene:ENSTNIG00000014555 transcript:ENSTNIT00000017801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSESAAASKAAGCGCGNPERAAVVENAEPGPVPAEPAVKYSRGANGRALLYPLPYLYFMM
VLVPGGAFLMGTDDPGIPADGESPQRLVYVDSFYMDTHEVTNRQFQMFVNATGYVTEAEK
FGDSFVFEGILSDKVKKEITQAVAAAPWWLPVKGANWKHPEGLGSSITDRLDHPVLHVSW
TDARTYCSWLDKRLPTEAEWECACRGGLKDRLYPWGNKLNPKGKHYANLWQGDFPNYNTG
EDGFVKTSPVMSFPPNGFGLYDIVGNVWEWTSDWWTVHHSAENQSNPTGPQSGNDKVKKG
GSYMCHKSYCYRYRCAARSQNTPDSSASNLGFRCVSGGTVT
Download sequence
Identical sequences H3DAN8
ENSTNIP00000017580 ENSTNIP00000017580 99883.ENSTNIP00000017580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]