SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017588 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017588
Domain Number 1 Region: 1265-1530
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-55
Family YWTD domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 3023-3281
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-54
Family YWTD domain 0.00000235
Further Details:      
 
Domain Number 3 Region: 3867-4143
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-46
Family YWTD domain 0.00000411
Further Details:      
 
Domain Number 4 Region: 1888-2143
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-45
Family YWTD domain 0.0000168
Further Details:      
 
Domain Number 5 Region: 1580-1835
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-40
Family YWTD domain 0.0000439
Further Details:      
 
Domain Number 6 Region: 200-466
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-39
Family YWTD domain 0.0000746
Further Details:      
 
Domain Number 7 Region: 534-778
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-38
Family YWTD domain 0.00000946
Further Details:      
 
Domain Number 8 Region: 2197-2466
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-35
Family YWTD domain 0.0000394
Further Details:      
 
Domain Number 9 Region: 2929-3015,3274-3335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-23
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 3780-3860,4144-4183
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1169-1257,1523-1575
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 12 Region: 847-888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 13 Region: 3566-3605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 14 Region: 3363-3402
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 888-930
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 16 Region: 2728-2762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 17 Region: 2810-2846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 18 Region: 973-1010
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 19 Region: 3650-3694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 928-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 21 Region: 2768-2802
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 22 Region: 1013-1051
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 23 Region: 3527-3567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 24 Region: 24-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2690-2725
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 3483-3524
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 27 Region: 3608-3643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 28 Region: 3444-3481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 29 Region: 1056-1096
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 30 Region: 2594-2635
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 2847-2887
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 32 Region: 2898-2939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 33 Region: 3326-3360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 3695-3728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 3733-3772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 71-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 2554-2595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 38 Region: 144-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 39 Region: 1842-1892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.01
Further Details:      
 
Domain Number 40 Region: 3407-3445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 41 Region: 2518-2556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 42 Region: 1841-1883,2154-2204,2467-2519
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000832
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 43 Region: 1102-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 2653-2684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 45 Region: 1141-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 46 Region: 4378-4414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017588
Domain Number - Region: 4234-4268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4201-4230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000554
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 4269-4303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000695
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 805-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 4305-4343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 487-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00514
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 116-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0152
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017588   Gene: ENSTNIG00000014562   Transcript: ENSTNIT00000017809
Sequence length 4550
Comment pep:known_by_projection chromosome:TETRAODON8:11:7598882:7642680:1 gene:ENSTNIG00000014562 transcript:ENSTNIT00000017809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFIPLFSLGPTLMFLCLSCFSSAPKTCSPKQFVCKDGVTCISKGWRCDREKDCPDGSDE
EPDVCPHSTVARCPPNEYRCGGTEVCIHMSRLCNGVPDCTDGWDEGPHCRELITNCSLRG
CQESCGITPTGSACYCKSGYEIGPDGKACKDFDECSVYGTCSQSCTNTNGGYTCSCVEGY
LPQPDNRSCKAKNVPVDRLPVLLIANSQNIQATSLSGTTVHSLLSTTTKQTTAMDFLYAE
EKVCWIHVGDAPPSTHLKCARIPNLKSFTEERIINISLSLHHVEQMAVDWLTGNFYFVDD
VDDRIFVCDKNGQTCVTLLDQELYNPKGIALDPTVGKVFFTDYGQIPKVERCDMDGQNRT
KLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYGLTVF
ENYLYATNSDNANMQPKTSVIKINRFNSTDYQVVTRVDKGGALHVYHQRRQPPVRSHACE
LDQFGKAGGCSDICLLGNGHKTRTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGVIR
GMDMNAKVPDEYMIPIENLMNPRALDFHAESEFIYFADATSYIIGRQKIDGSERDTIVKE
GGIHIVEGIAVDWMADNLYWTDDGPKKTISVARLEKASQTRKTLIEGKITHPRAIVVDPL
NGWMYWTDWEEDPKESKRGRIERAWMDGSNRNMFLSSKTVLWPNGLSLDVPQGILYWVDA
FYDRIEMVYLNSSERKTVYEGQELIHAFGLCHYKHFLFWNEYRSGSIYKLDSTTGTVTLL
RSERPPIFEIRMYDAQQQQAGSNACRVNNGGCSSLCLATPGGRQCGCADDQILDPANNTS
CKANPSYKPPPQCQAGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFK
CKNNRCIPLRWLCDGDNDCGNDEDESNTTCSARTCPPNQYSCASGRCIPISWTCDLDDDC
GDRSDEPASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSAQFK
CNSGRCIPDYWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRMDSLCIPLRWR
CDGDTDCMDLSDEKNCEGVTHMCDPAVKFGCRDSARCISKAWVCDGDSDCEDNSDEDNCD
ACKLSHHVCANDSTICLPPEKLCNGADDCPDGSDEKLCDLCSLENGDCSHNCTVAPGEGV
ICSCPLGMELGPNNKTCQIQSFCAKHLKCSQRCQQDKFSVKCSCYEGWELEPDMENCKST
DPFKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTIALDFHLNQSALYWTDVVEDKIYRG
KLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAG
EVEHPRAIALDPRDGILFWTDWDASMPRIEAASMSGEGRKTIHKETGNGGWPNGLTVDYL
ERRILWIDARSDAIYSAKYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKA
NKWTGSNVTVVQRTNTQPFDLQVYHPSRQPQAPNPCAAKDGKKPCSHLCLINYNQTFSCA
CPHLMKLGPDRRNCYEFRQFLLYARQIEIRGVDIDNPYYNYIISFTVPDIDNVTVVDYDA
LEHRIYWSDVRTQTIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDANKKQI
NVARLDGSFKNAVIQGLDKPHCLVLHPVLGKLYWTDGDTINMANTDGSNRSILFTNQKGP
VGLSIDFDTEALYWISSGNSTINRCKLDGSGLEVLEGTKGKLTKATALAIMGNTLWWADQ
GTDQIGTCDKTDGGNWKVLRNSTSPMMHMKIYNETVQEVFPGTNLCSINNGDCSQLCLPT
SPTTRACMCTAGYSLRTGQQSCEGVGSFLLYSVHEGIRGIPLDPSDKSDALVPVSGTSLA
VGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQ
GFDVIEVARLNGSFRYVVISQGLDKPRAITVHPERGYLFWTEWGQYPRIERSRLDGSERA
VLVNVSISWPNGISIDYEENLLYWCDARTDKIERINLETGENREVVLASNNMDMFSVSVF
ESYIYWSDRTHANGSIKRGSKDNATDSVSLRTGIGVQLKDIKVFNRARQQGTNVCKVNNG
GCEQLCLFRGNGQRTCACAHGMLAEDGCSCRDYDGYLLYSERTILKSVHLSDENNLNAPI
KPFEDPEHMKNVIALTFDYRGGGGKGANRVFFSDIHFGNIQQISDDGSDRKTVVENVGSV
EGLAYHRGWDMLYWTSYTTSTITRHTVDQSRWGAVDRHTVVTMSGEDHPRAFVLDECQSL
MFWTNWNEQSPSIMRATLTGSNVIVIIGSDIRTPNGLAIDHRAEKLYFSDATLDKIERCE
YDGTRRYVVLKNEPVHPFGLAVYGDYIFWTDWVRRAVLRANKYTGGDMKLLRADIPQQPM
GIVAVANDTNSCEFSMCRVNNGGCQDLCLLTSEGRVNCSCRGDRKLLEDSTCSALNTTCN
VVDGFECGNGDCINYTLTCDGMAHCKDKSDEKQSYCANRVCKKGYRRCVNGRCVGHGSWC
NGRDDCGDNSDEIFCNTTLCTADQFQCRDGSCISNSSKCDQKVDCEDAGDEMNCTATDCS
SYFHLGVKGVTFQKCEFTTLCYAPSWLCDGANDCGDFSDERNCPGSSKEKCPTPFFACPS
GRCIPKSWTCDKENDCENGADEAHCDKFCSATQFQCANNRCIPQRWVCDGADDCGDSSDE
DSQCKTKTCSPEAFQCPGSHMCIPQRWKCDGDKDCPDGTDESVKAGCVFNNTCSSNEFMC
QNRQCIPKHFVCDHDNDCGDGSDESQECEYPTCGPKEFRCANGRCLIQSSWECDGDFDCH
DQSDEAPLNPRCGGPANKCNNTAYACSNGNCVNETLLCDRKDDCGDGSDELNCFINECLN
SKLSGCSQLCEDLKIGFKCRCHPGFRLKDDRKTCIDIDECTTTYPCTQRCINTHGSFHCL
CVEGYHLSPENPTICKSTSDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDY
RQQMIYWTDVTTQGSMIRRMYINGSDVQVLHRTSLSNPDGLAVDWVGGNLYWCDKGRDTI
EVSKLNGAYRTVLVNSGLREPRAVAVDVRYGYLYWSDWGDNPHIGRIGMDGTNRSIIIEE
KITWPNGLTLDFVNDRIYWADAREDYIAFASLDGTRRHTILVKDIPHIFAMSLFEEYIYW
TDWETKSINRAHKTLGTNKTVLISTLHRPMDIHIYHPYRQPEVENHPCQMNNGGCSNLCL
ISPGGGYQCACPTNFYLAADGKQCLSNCTASQFVCKNDKCIPFWWKCDTEDDCGDRSDEP
ADCPEFKCRPGQFQCGTGICTNPAYICDGDNDCHDNSDEANCEPDIHVCLPSQFKCTSPS
RCIPGIFRCNSQDNCGEGEDEKDCPEVTCAPNQFQCAITKRCIPRVWVCDRDNDCVDGSD
EPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDASDEPKEECDERTCEPYQFRCK
NNRCVPGRWQCDYDNDCGDNSDEDKCVPRQCSESEFACTNGRCIAGRWKCDGDHDCADGS
DENGCEVKCDSDQYQCKNSHCIPLRWHCDADPDCLDGSDEEKCDSGVVRHCPKDEFQCNN
TLCKPQGWKCDGEDDCGDNSDENPEECVIFQCPPTRQFRCLNDRVCLPLSKRCDGVNNCG
DNSDELDCQVPPPIPVCQKHEFQCSNGRCISSIFRCNYFNDCEDYGSDEINCNKKDTALN
DCRSNRTVCGDGDEAHCVVNGTDSFCSCRPGFQTNGRNRCEDKNECLQFGVCSHMCNNTK
GSYKCGCHKYFTKINDTCKADAQRQLLYIADDNEIRSLDPSIPNWRYEQIFQGDANVRID
AMDIHVKTNRIYWTNWHTGRISSYDLPSASLSPNNNRNRRQTDSRVTNVEIPDLKMPRGI
AVDWVAGNLYWTDSGRDVIEVAQISKTHHRKTLISGMIDEPYAIVVDPQRGRMYWADWGN
HPKIETAAMDGTMRETLVEKNIQWPTGLAVDYFNERLYWADAKLSLICSVRLNGSDAVVA
VNSLRKLRQPFSIDVFEDYVYGVTYINNYVFRVNKFGKGPIENLTTGMNHATDIVLYHRY
KQPEVNNPCDSKKCEWLCLLSPSGPVCTCPNGHMLNNGTCVETPTPTLSPIGPPSGPCLV
QCLNGGSCFLNAHKQAKCRCQPNYGGDRCEIDQCRDYCKNGGTCTPSPTGSPTCRCLTGF
TGRNCNLHTCKNYCKNGGNCTVSSGNQPTCQCSHDFLGDQCQYRSCEGHCLNKGKCLQTE
NGSKLCRCLPQYTGATCEIDKCHYCRDGECIPSNSFTSRGDFTCRCTNGRVQPSCYTCDT
NEYCANGQCSVNPTTRLPQCKCSPGWAGHRCESVATSESTSGSGTASIVIPVVLLLLLLI
LLAAGTLFWYRRRMRGAKGFQHQRMTNGAMNVEIGNPAYKIYEGEPDDDAGELLDADFTL
DPDKPTNFTNPVYATLYMGAHNSRNSLASTDENKELLSRGDEEPLVDPLA
Download sequence
Identical sequences H3DAP6
ENSTNIP00000017588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]