SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017604 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017604
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily EF-hand 1.87e-35
Family Calmodulin-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017604   Gene: ENSTNIG00000014577   Transcript: ENSTNIT00000017825
Sequence length 150
Comment pep:known_by_projection chromosome:TETRAODON8:11:7450100:7452599:1 gene:ENSTNIG00000014577 transcript:ENSTNIT00000017825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLSVFILEFKEAFSLFDRTGDGRITYSQCGDVMRALGQNPINADVLKVLGNPKIEEMN
HKLLDFEQFLPMLQDIDKNRDQGSFEDIVEGLRVFDKEGNGTVMGAELRHVLTTLGEKMT
EEEVETLLAGHEDANGSINYEELVRMVMNG
Download sequence
Identical sequences H3DAR2
99883.ENSTNIP00000017604 ENSTNIP00000017604 ENSTNIP00000017604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]