SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017605 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017605
Domain Number 1 Region: 85-187
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.71e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000737
Further Details:      
 
Domain Number 2 Region: 183-296
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 7.33e-20
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000709
Further Details:      
 
Domain Number 3 Region: 32-83
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000119
Family TS-N domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017605   Gene: ENSTNIG00000014578   Transcript: ENSTNIT00000017826
Sequence length 302
Comment pep:known_by_projection chromosome:TETRAODON8:11:7447717:7449539:1 gene:ENSTNIG00000014578 transcript:ENSTNIT00000017826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGFLFRTAAKLGVCQHVQPLHTGCQLLAAEKALLMKLRKNTGYTFTNCKKALEKFDND
LTQAETWLHEQAQKEGWSKANKLEGRKTKEGLIGLFIGDNEAVMVEVNCETDFVARNEKF
QQLVKDVAMATLAHRPKKGQAGYVKNFLSNEDLNKLSLDDGVSLADQVALTIGRLGENMS
VKRAVTVGVPAEWRIGSYVHGGVGTQPELAMGRYGALVIFEGGKKGEEDVLGRQLGRHVV
GEAPQSLGNMDDLPCGESETRLLPQTFLGDPSRTVAQFLKGQQARVFDFIRFQCGETLDE
KK
Download sequence
Identical sequences H3DAR3
ENSTNIP00000017605 ENSTNIP00000017605 99883.ENSTNIP00000017605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]