SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017624 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017624
Domain Number 1 Region: 683-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.79e-69
Family Protein kinases, catalytic subunit 0.000000039
Further Details:      
 
Domain Number 2 Region: 300-495
Classification Level Classification E-value
Superfamily L domain-like 2.64e-45
Family L domain 0.00000683
Further Details:      
 
Domain Number 3 Region: 22-177
Classification Level Classification E-value
Superfamily L domain-like 1.08e-39
Family L domain 0.0000242
Further Details:      
 
Domain Number 4 Region: 480-613
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-20
Family Growth factor receptor domain 0.00000316
Further Details:      
 
Domain Number 5 Region: 153-306
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.81e-17
Family Growth factor receptor domain 0.000000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017624   Gene: ENSTNIG00000014596   Transcript: ENSTNIT00000017845
Sequence length 1294
Comment pep:known_by_projection chromosome:TETRAODON8:11:7326419:7333948:-1 gene:ENSTNIG00000014596 transcript:ENSTNIT00000017845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCTGTQNFLSMTGNSEIHYNLTKTLYTGCEIVMGNLEITMMEHGMDFSFLKSIREVTGY
ILLAVNTFSRLPLDNLRVIRGNELYENQYALVVMINYPTKGGQGLQELGLTHLTEILQGG
VKITQNRDLSFAPKVNWLDIVKDGTANITIFDNGPEKPCHKACGDVPCWGPGSDMCQILT
KTVCAPQCNFRCFGRSPGECCHSECAGGCTGPLDTDCFACRKFNDSGSCVPQCPMALIYN
KYTFRLEPNPNAKFQFGSICVAQCPPNFLVDGTSCVRSCPADKMEVEKNGVKRCEPCGGL
CPKACHGTGSPNGETVDALNIDSFINCTKIQGSLHFLLTGINGDNYNNVPPLDPEKLKIF
NTVREITDMLVIQSWPTNMSDLSVFSNLQTIQGRKLYKLVFRGYSLMVVKTPSLTSLGLR
SLRKINDGGVYITGNKNLCYHDTVNWTLLLGSSSRQQRRHKNIDIKDNRPRSDCVRENFV
CDPLCSSDGCWGPGPSQCLSCKKYSRGGICVADCMFLAGDRREFATASGECMPCHPECKA
QTGRETCTGPGAAECLECANLQDGPHCVSSCPEGVMGGEEIIFKYPDKQGRCEPCHGNCT
KGLSCYGPGIRDCVEAYGQTVTGIVVGVIVLLFVSFSVFVLTLLYRRGLAIRRKRAMRRY
MERGESFEPLEPGEKGAKVHARILKPSELRTAKLLGNGVFGSVYKGIWIPEGETVKLPVA
IKVIHDRPGQKTFSKPTEHMMTLGSLDHVNIVRILGICPGDSLQLVSQLSSQGSLLEHVR
NCKNKLNPQRLLNWCVQIAKGMYYLEENKVVHRNLAARNVLLKNNYTAQVSDYGVADLLY
RDDKKYFFNEAKTPIKWMALESILFRKYTHQSDVWSYGVTVWEMMSYGAEPYNTMRPQDI
SDLLEKGERLSQPQICTIDVYMVMVKCWMVDENVRPTFKELANEFTRMARDPPRYLVIKE
DCSQQDTAPDLDDLDFNEGVDAEMVNEVKEDEEDGLVPAPYYVPQSLGRLSKMDSYRVVL
SSSNVAGYLPMTPGVDSTLTRICVFDPLQAPWPSRSRLNSGRAVSEGSEGCGPVVDGDVS
EDFSMSGSPKRRRNRHDSAYTSQRDSMSGGLSETPTPDMEEEDQNGYVLPGDSPKRDALF
PTSQGVPGRMGKSHSSSLLDDPDDEEYEYMNKQTMSSYNSDSEPQGSDDVKYEYMDIRSV
GKDDSPPAHAPPPPPADRQPAEAARPEEAAVYQNIQREGEGPAGQSPAQRSGFGAYVSVR
AGVGLGDPAAVDRSFDNLEYWHSRMFPNPKAVQT
Download sequence
Identical sequences H3DAT2
ENSTNIP00000017624 99883.ENSTNIP00000017624 ENSTNIP00000017624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]