SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017655 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017655
Domain Number 1 Region: 31-186,214-338
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.62e-61
Family FCH domain 0.0023
Further Details:      
 
Domain Number 2 Region: 501-695
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000876
Further Details:      
 
Domain Number 3 Region: 746-801
Classification Level Classification E-value
Superfamily SH3-domain 4.94e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017655   Gene: ENSTNIG00000014626   Transcript: ENSTNIT00000017876
Sequence length 1091
Comment pep:known_by_projection chromosome:TETRAODON8:11:6898949:6923823:1 gene:ENSTNIG00000014626 transcript:ENSTNIT00000017876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMSSTRVRKDKEIIADYETQVKEIRNQLVEQFKCLEQQSESRIQLLQDLQEFFRRKAEVE
LEYSRSLEKLTERFSSKIRSSREHQQFKKDQHLLSSVNCWYLLLTQARRESRDHATLSDI
YTNNVIVRLAQISEDVIRLFKKSKEIGIQMHEELVKVTNELYTVMKTYHMYHTESISAES
KLKDAEKQEEKQFSKSGDLNVNLLRHDDRQPRRGFVRKIEKMKEKRQAKYSENKLKCTKA
RNDYLLNLAATNAVVAKYYIHDVSDMIDCCDMGYHASLARTFRTYLSAEYNLETSRHEGL
DIIENAVDNLDSRNDKHKIMDMHNQVFCPPMRFEYLPHMGDEVCQVSAQQPVQTELLMRY
HQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSIASESY
MSKLNVAKRRSNQQETETFYFSKFKEYLNGSNLIIKLQAKHDLLKQTLGEGERAECGTTR
PPSLPPKPQKMRKPRPRSMYNRRLFNGNLESFIQDSGQPIPLVVESCVRYINLYGLQQQG
IFRVPGSQVEVNDIKNSFERGEDPLTDDQNEHDINSVAGVLKLYFRGLENPLFPKERFLD
FISTIKLESGAERAHHIQQIVATLPRTVIIVMRYLFAFLNHLSQYSDENMMDSYNLAICF
GPTLMPIPDGQDPVACQAHVNEVIKTIIIHNEVIFPSQRELDGPVYEKCMTGGEEYCDSP
HSEPGTIDEADNGTETHTSDEEVEQIEAIAKFDYVGRTPRELSFKKGASLLLYHRASEDW
WEGRHNGVDGLIPHQYIVVQDLDDAFSDNLSQKADSEASSGPLLDERGSCKNDAPSPCDQ
GPDYSFGGVLGRVRLRSDGAAIPRRQSGTETHSPTRAADTPPRAAVCPGSPHKISIGKTR
MESPEKRRQGPFGSAGSIYPDRKAYPEGHPLRPVAGATRHSSLGDHKSLEAEALAEDIEK
TMSTALHELRELERQNTVKQAPDVVLDTLEPMKNPVSSEPGSPLHTIMIRDPDAAMRRSN
SSTSEMMTTFKPALSARVAGAQLRPPPMRPVRPPSGQHRSSSSSSSGVGSPAVTPTEKMF
PSSSAAGGPSV
Download sequence
Identical sequences H3DAW3
99883.ENSTNIP00000017655 ENSTNIP00000017655 ENSTNIP00000017655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]