SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017665 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017665
Domain Number 1 Region: 51-177
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-34
Family Phosphotyrosine-binding domain (PTB) 0.00035
Further Details:      
 
Domain Number 2 Region: 465-543
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-19
Family SH3-domain 0.00038
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017665
Domain Number - Region: 594-643
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000807
Family Pointed domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017665   Gene: ENSTNIG00000014636   Transcript: ENSTNIT00000017886
Sequence length 646
Comment pep:known_by_projection chromosome:TETRAODON8:11:6819784:6822717:-1 gene:ENSTNIG00000014636 transcript:ENSTNIT00000017886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSALYCDACCDSGYPAMDESASQSSNVSRPNARSIYLQRKEYAASVRQIMDITQYRVEHL
FTFELDGRQLRNVSDCVEQLQLLEEMGRVWGQSMLLQVQPPRLLLTDIETKMELESVAIG
DVLEVKAVLDSGPFNSLLTVSVQTRRRGSTSIFVFQSDIRVSAADLIQRDLSRALLNKPK
TSSGPVAPPPQWAAPGWGESVRLHSDFSEDEDVPEPKVFAPEEEEPLQPSSKPYTQLEGR
VDILNHILNDIEIVMGQVGAALAKKAAKKKKKKGARKKKVPKKSNYSMPTATEFASCLQK
IKYGFNLLAELNGQISNPTAPEYVHFFFSTLAFVAPHSPVGLPMTIVVPLLTPACVQLLS
LEVTQEEDRLWQSLGDAWNVPSNEWPHGDVQTYVPEFTDGWQPPQLAAAAKDPPSRVEAR
QPASSRVSPGGHSDLGTGGKAKWKPPPPPQEPSWSLNASHVLACPPSPPEPQYMRVMHDF
TSRNSKELTIRKGDIVELLDMSRQWWKVRDARGEVGYVPNNVLEPYEEQLEQVGPNVNRR
SYITHWETGRFREGGGQVSQNASSAGIPVIHSDLVQYSQQTGGPVVLTRSSRPVEVKTWL
EYKAFSRITVRCLGGLSGATLLGMTKEELKTLCPEEGGRVFFQLQV
Download sequence
Identical sequences H3DAX3
ENSTNIP00000017665 ENSTNIP00000017665 99883.ENSTNIP00000017665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]