SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017682 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017682
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily vWA-like 1.04e-27
Family Integrin A (or I) domain 0.0016
Further Details:      
 
Domain Number 2 Region: 181-347
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000118
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017682   Gene: ENSTNIG00000014654   Transcript: ENSTNIT00000017905
Sequence length 376
Comment pep:known_by_projection chromosome:TETRAODON8:11:6657174:6658698:-1 gene:ENSTNIG00000014654 transcript:ENSTNIT00000017905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDILLLLDSSGSVSNNEFSRFLRFSAGVLRIFPLGRGRLRVGLVQVGTNPKLEFGLEVH
SDQESLQEALRGVQQLQGDTNTKDALVLAQKLLQAADRGAPKILLWLTDGAEPGDVGQLL
LEVKAGGVVVIAVSTVHGSHQLREAVSCLYVVDIDHIEIITKNLIDAITFSYFLEIFQVN
RLQVVSLTPRRATLQWCPLLTAATGCYLLQYHPVRNPAASSHMYLPGHSSWVELTSLTPG
ATYTAVLHPMATQRVFQAASVTFSTPPECLSPAVVSVSDSGPHHIRVEWGPLQGAQVLRY
TVEYGAIPSGCVNTVALHCHQNFTFLTGLEPATQYLVTVSAWCADGRERSMSVRACTGRR
DLSPERLLADLGARQA
Download sequence
Identical sequences H3DAZ0
ENSTNIP00000017682 99883.ENSTNIP00000017682 ENSTNIP00000017682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]