SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017718 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017718
Domain Number 1 Region: 221-448
Classification Level Classification E-value
Superfamily vWA-like 1.31e-33
Family Integrin A (or I) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017718   Gene: ENSTNIG00000014688   Transcript: ENSTNIT00000017941
Sequence length 919
Comment pep:known_by_projection chromosome:TETRAODON8:11:6357583:6366032:-1 gene:ENSTNIG00000014688 transcript:ENSTNIT00000017941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLEAIMGRASAPLSLFGLLLAVVTALPVRENWDIYSYHINSTVTSRYAITVITSRVANR
MEESKEIEFHVRIPKNAFITKFKMVIDGQEYDGIVKEKEKAQQQYSQAVSRGQSAGIVSS
VGRTLEEFKTSVTVAAHKKVTFELTYEELLKRRLGKYELQIHARPMQPVKDFKVDVYINE
NAGINSFMVKGGLSTKELANAVTTTQAEKEAWVHFYPTVDQQKSCDSCDDKGMNGDLIVV
YDVNRNTSLGDIQRSPGYFVHHFAPSNLQRIPKNVVFIIDQSGSMHGRKIEQTRTALIHI
LNDLAEDDFFGLLTFDSNIFQWKRELVQATKANLESAKTFARNIRANGATNINAAVLKGS
SMLNAHPREGSASILILLTDGDPTTGETNPEAIQSNVRNAIAEKFPLYCLGFGFDVNFEF
LEKMSLQNNGVARRIYEDSDADLQLKQQGFYEEVATPLLTNVMMIYVGGTNLTKTSFSHH
YKGSEIVVAGVISDNDVETFAPQVVAISKSRRLVFDDKNATTETSVMASDSQMQRIWAHL
TVKQLLDKELHLSGSEKEDAKNEALKLSLRYGFVTPLTSMVVTKPQGESTDVLDKPKEGN
TWPRGGVAGPPFHGFGSAAPGKIWTMFQWHTKGNSHISGNAGPPGLPGSRYIGAAGYPGH
ATRHYLKESAVCQKGCQCTQHKCVSFQPPLFMILLLLPTMSMTTECLPRLSQQLPQPLQV
NFMRKPADGSLPLCFDVPVGRLKLLHHPNMAELTVNGELSSETPGFSKIVIHLKEDQHVE
VDSSKIVVRDKQSVSHYSGDEPHTVGSITVIRRAKEIDITVGDTRMVILIHLHQGKEFLW
PVLRQRPSDSGVTGILGLQPVVYEEQFPEKLKIDSREIEATRRTAVDYSEAVPRQQDCWR
TSAEDALQAPLHHFTISEL
Download sequence
Identical sequences H3DB26
ENSTNIP00000001501 99883.ENSTNIP00000017718 ENSTNIP00000017718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]