SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017728 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017728
Domain Number 1 Region: 33-354
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-123
Family Bee venom hyaluronidase 0.00000987
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017728
Domain Number - Region: 416-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0389
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017728   Gene: ENSTNIG00000014698   Transcript: ENSTNIT00000017951
Sequence length 462
Comment pep:known_by_projection chromosome:TETRAODON8:11:6228683:6230241:-1 gene:ENSTNIG00000014698 transcript:ENSTNIT00000017951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRPWLLLHLFASWTVLCSANLKPARWPLYPQKPVLLAWNAPTQECFPRHRVSLSLDLFDI
VATPNEGFVRQNLTIFYKERLGLYPYYEHGGTAVNGGLPQLASLTEHYEKMPEGIKKYIR
DSQAKGLAVIDWEEWRPLWIRNWDMKDIYRSKSRELVAKKNPRWTAEQVAKVAQQEFELS
ARKFMLETLKHAKNLRPNQVWGFYLFPDCYNRDYNKNLKNYTGHCPSWEIKRNDQLDWLW
MECTALFPSVYMESVLSSTNSGRLFVRNRVKEAMRLASIGDGLARPVFVYTRPTFINQMT
LLTETDLVSTIGESVALGAAGIIFWGDTSYASNSASCSTLNRYLEDQLGRYLLNVSTAAE
QCSEILCNNHGRCLRKTQESDVYLHLSPSTHNITTLDRRLKVSGAPGPAERNFFRTHFQC
QCYSGYGGEACSQREKGKNRAASFLGPWPLLVLLPLGLLFLM
Download sequence
Identical sequences H3DB36
99883.ENSTNIP00000017728 ENSTNIP00000017728 ENSTNIP00000017728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]