SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017754 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017754
Domain Number 1 Region: 7-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000549
Family EGF-type module 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017754   Gene: ENSTNIG00000014720   Transcript: ENSTNIT00000017977
Sequence length 98
Comment pep:known_by_projection chromosome:TETRAODON8:11:6033134:6034667:-1 gene:ENSTNIG00000014720 transcript:ENSTNIT00000017977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAAVWSHFAECPDSHRHFCLHGSCRFLTLEETPACVCHQGFVGMRCEHADLLAVVATNH
RQTVTTVLVLCVIACVLVMVLCTLLQCKITKTHSMLLF
Download sequence
Identical sequences H3DB62
ENSTNIP00000017754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]