SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017783 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017783
Domain Number 1 Region: 39-504
Classification Level Classification E-value
Superfamily Sema domain 3.01e-122
Family Sema domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 1061-1332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-77
Family Protein kinases, catalytic subunit 0.00000000571
Further Details:      
 
Domain Number 3 Region: 654-745
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000765
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.069
Further Details:      
 
Domain Number 4 Region: 550-627
Classification Level Classification E-value
Superfamily E set domains 0.0000000000098
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 5 Region: 507-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 6 Region: 745-847
Classification Level Classification E-value
Superfamily E set domains 0.0000000217
Family Other IPT/TIG domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017783   Gene: ENSTNIG00000014746   Transcript: ENSTNIT00000018007
Sequence length 1377
Comment pep:known_by_projection chromosome:TETRAODON8:11:5562141:5569641:-1 gene:ENSTNIG00000014746 transcript:ENSTNIT00000018007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTWTALLTICIWILTPTASGQHACASGPRQWVDFTVEYSLPHFQTSNPVQNIAVNWDSQ
QKEIYIGCQNAIKAVTGNMEEMWELKTGPVGSPDCETCKLCDVEADPEDPVDTDSEVLVL
DPAVELLPYLYICGSTQHGICYFIDISPPERAPKCLYKKEHNSPTHCPDCLASPLGTKVT
IVEEGATSYFFVAATVDDRVAQKYPRRSISMMRPLSTEDGFDMVNNGLTVLPGLRSTYKI
EYIYSFSTKDFVYFLSLQREDPSKSNSPFQTRLGRMPISIQEVWMYREVVLECHFNPKRR
RRENFKDIVYNGLQAAYFGRAGKDLVEELRVDEHEDILYGVFAEVNELGQPQKNSALCAF
PLTKINYAIDKGVEACCQSGTEQLSRGLGHFQPLESCPHESSQDNNTCSSKPTLVAQPHY
RLDLFNQKMRDVLFTAVLVTTNGNHTLGHFGTSDGRILQVILSLYRHVVFANYSLGDGEV
SRTAAVYAEDSLLFVVGNKMFKVPSQGPGCAHFRTCSMCLMAPRFMNCGWCSGVCSRQHE
CTSQWTSASCAPIITEVSPKVAPVGGETEVTLCGWEFQSPLRPAIINGKTHRVTVGSTTC
AVLPEKSSSEKLVCKIQEKNKPGQDLKMVLEVHEGEVEGRYSIEGSAQIRGFSFVEPSVT
DLKPDSGPVFGGTTVTLTGRYLDSGSQRDVLFGDERCSILSVSGGPEPSSSIICRTAAAE
DVGSVPVTVLIDSFQVTTTKTFHYKINPVVTSVEPRCSVQRHRGSRLVIQGQNLDSAHKT
VVKYVSKNTNLHQLQRVCNGSTNATHMECWAPAFPEEMPDEKESGQISIHMEDQREVWNS
SFEYHSNYEVLPFENEDKILLLRPGENEVSLHHKKLDRVSACMDVTMSIGGVNCKAQVLL
NELTCRIPKSLVIPASGLPVKVSVGWEVYDVGTVGNDDSNNTKVIVGIVLGILAALVAGA
VLAFAVMIHLKKKKIANIENRLSTMLSHTRSSGAADFSPTGDYRRVDLSSQTSGSGGMAF
QGLLYAASYDHLAIPLMSHDNISMVSLNPDLLEEVKNVLIPADMLRIEDSQIIGKGHFGT
VYHGYLIDSNKQETHCAVKSLNRITDLKEVNQFLREGLIMKGFDHPNILSLLGIMLPKEG
LPLVVLPYMKHGDVRHFIRSEKRNPTVKDLIGFGLQVAKGMEYLAQKKFVHRDLAARNCM
LDETYTVKVADFGMARDIYDKEYYSIQDHKQVKLPVKWMALESLQTQKFTIKSDVWSYGI
LMWELLTRGASPYPDVDPYDITHYLLKGRRLPQPQFCPDTLYSIMLSCWDPEPDYRPSFS
SLTADVQHILLCLQGEHYINLKVHYVNLDQPRPYPSLTGSADEAEASDPDTDSQQTS
Download sequence
Identical sequences H3DB91
ENSTNIP00000017783 ENSTNIP00000002265 99883.ENSTNIP00000017783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]