SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017785 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017785
Domain Number 1 Region: 5-117,147-512
Classification Level Classification E-value
Superfamily Sema domain 5.76e-173
Family Sema domain 0.0000000000461
Further Details:      
 
Domain Number 2 Region: 574-657
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000428
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 3 Region: 508-559
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000732
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017785   Gene: ENSTNIG00000014748   Transcript: ENSTNIT00000018009
Sequence length 752
Comment pep:known_by_projection chromosome:TETRAODON8:11:5477614:5491839:-1 gene:ENSTNIG00000014748 transcript:ENSTNIT00000018009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELKSTGTAHHFSFLLNSTDYRILRMDEDHDRMYVGSKDYILSLDLNDINKEPLIIHWPVA
SQRKTECVLSGKDTNGECGNFIRLIEPWNRTHLYVCGTGAYNPVCTYVDRGRRSQGFHYL
HASQSGGRTSRAADHGATESLEAKEYIFRLEPGKVDSGKGKCPFDPKLNSVSALINGELY
AGVYIDFMGTDSAIFRTLGQKTAMRTDQYNSRWLNDPTFVHAHLIPDSAEKNDDKLYFFF
REKASEMGQSPMTQSRIGRICLNDDGGHCCLVNKWSTFLKARLICSVPGTDGIETHFDEL
RDVYIQPTQDTKNPVIYGVFSVSGAVFKGSAVCVYSMADIRMVFNGPFAHKEGPNYQWVA
YTGKIPYPRPGTCPGGTFTPNMKSTKDYPDEVINFMRNHPTMYNVVYPVHKRPLVVRTNV
DYEFTTIAVDQVTAADGSYEVLFLGTDRGTVQKVIVLPRDDLQTEELVLEEVEVFKVPTP
ITTMKISSKRQQLYVGSVLGVTHLALHRCDVYGEACADCCLARDPYCAWDGKSCSRYSNS
QKRRSRRQDVKYGNPIRQCRGYNSNTNKNTLETVQYGVEGSTTFLECQARSPHMSLKWHL
QKENSDRRKEIRSEGRILKTEHGLLIRSLQPSDGGIYQCTSTEKNFKHTLVKLQLVVLSS
RTVNNVLVETGSPALPPLQSSPWTPNAGQYKDLLTILSQPEMGLINQYCQDYWQLGEGGL
GDGKAKSLKELKEQKKPRNRRHHDEETTPAET
Download sequence
Identical sequences H3DB93
ENSTNIP00000004467 99883.ENSTNIP00000017785 ENSTNIP00000017785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]