SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017801 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017801
Domain Number 1 Region: 133-303
Classification Level Classification E-value
Superfamily vWA-like 1.02e-26
Family Integrin A (or I) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017801   Gene: ENSTNIG00000014763   Transcript: ENSTNIT00000018025
Sequence length 999
Comment pep:known_by_projection chromosome:TETRAODON8:11:5346130:5375667:1 gene:ENSTNIG00000014763 transcript:ENSTNIT00000018025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QENAISYYDSKADSDYTEDGEEENPLESSTSLELEFVDDPNFKNKVNYSSSAVQIPTDIY
KGSPVILNELNWTQALERGFIENFRDDSSLRWQVFGSATGVTRYYPATPWRAPNKIDLYD
VRRRTMYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVMEMLDTLSDDDYVNVARFNEK
ADAVVPCFRTLVQANVRNKKIFKEAVMHMQAKGTTDYKSGFTFAFEQLLNESSAPRANCN
KMIMMFTDGGEDRAQEIFEKYNWPNKTVRVFTFSVGQHNYDVTPLQWIACSNKGYYFEIP
SIGAIRINTQEYLDVLGRPMVLAGSKAKQVQWTNVYQDALGLGLVISGTMPVFNLTADPG
SSQNQLILGVMGVDVAINEIKKKTPTYRLGANGYTFAIDPNGYVLLHPNLRPKIINFREP
VTLDFLDAELEDSNKEEIRRQMIDGKSGQRKIKTLIKSVDERYIDEAMRTYTWTPVEGTD
YSLGLVLPTYSENHIKANLSDQILQLIFPLSVADFEALLPNSFESEGHVFIAPREYCNDL
ELSNNNTEFLLNFISLMEKVTPDSKHCDTLLLHNLILDTGIIQQLVEKVWKNKDLNTYGF
LAVFAATDGGITRVFPNKAAETWEEDPEPFNASFYRRSLDNKGYIFRAPYRSVLLFSLSS
ENDTTGILVSTAVEITVGGKTIKPAVVGVKLDLEAWTEKFKILASNHTDNRHTSNTCGPN
RGCEMDCDANSDELLCYLIDDGGFLIMSNQKEDWDKVGTFFSDVEPYLMYALYNNSFYKV
KQSYDYQSVCERLPNSEAGAAPRGVFVPTIADLVNLAWWTSAAAWSLFQQFVYGLAYQSW
FIRDEARAEGFDSKERSCVMIQTQYYLSNLSSSYNILQDCGNCSRLIHAKRINNTNLLFV
VAEKMPCSVCEIEKLTQEEEDLSADREDNPCEEMAVPRYRKGPSTCFDNNLSENTSDCGR
GHSFRASLHVLLLLQLLLLYDLPPTPSPQTHDRLERSGT
Download sequence
Identical sequences H3DBA9
99883.ENSTNIP00000017801 ENSTNIP00000017801 ENSTNIP00000017801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]