SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017802 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017802
Domain Number 1 Region: 39-360
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-119
Family Bee venom hyaluronidase 0.0000119
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017802
Domain Number - Region: 423-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00365
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017802   Gene: ENSTNIG00000014764   Transcript: ENSTNIT00000018026
Sequence length 464
Comment pep:known_by_projection chromosome:TETRAODON8:11:5265051:5267338:1 gene:ENSTNIG00000014764 transcript:ENSTNIT00000018026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFWTLPDWRVLLLSVLLWQRLCAEELTPTAWPLYSKKPLLLAWNAPTEDCAPRHGIDFQ
LNDFQIVASPNEGFVRQNLTIFYKERLGLYPYFEPDGTPVNKGLPQLVSLTEHLDKMKEG
VEKYIKDPRAKGLSVIDWEEWRPLWVRNWKSKDVYRRHSRELMQQKNPTMPPEQVVKAAQ
RDFESSAMKFMLETLKVAKNLRPQQLWGFYLFPDCYNHDYRHTLENYTGRCPDVEMARNE
KLESLWTESTALFPSIYIATELRSSSYGRQFVRNRVKEGMRLASSGRGLARPVFVYTRPT
YANSLEPLTETDLVSTVGESVALGAAGIIMWGDAAYASSRASCSNLSAYLQQPLRQYLLN
VSTAAELCSQALCAFHGRCQRRNPDSEVYLHLNPLSHTISSRSGRPEVSGDLGEADKSRL
GAEFRCQCYGGYHGERCEHADALSRGARPSALWCVILLTVSLLL
Download sequence
Identical sequences H3DBB0
ENSTNIP00000017802 99883.ENSTNIP00000017802 ENSTNIP00000017802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]