SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017804 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017804
Domain Number 1 Region: 389-434
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000000115
Family MYND zinc finger 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017804   Gene: ENSTNIG00000014766   Transcript: ENSTNIT00000018028
Sequence length 451
Comment pep:known_by_projection chromosome:TETRAODON8:11:5250549:5253254:1 gene:ENSTNIG00000014766 transcript:ENSTNIT00000018028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSVILPVEAEGFIQSLQAISLKEVGSKRWFRQHEYIEKLNMQAILNASAVHDEFVKDL
LVSYGKVPVLVHEMILIEVWKRSVFPILCQLSDFRPKNTFQLYMVIHHEATVINLLETIM
FHKDCCEAADDSVVDLVDYCHRKLTLLASKATREGPTGRDRGSPSHPKELQMQSAELEFE
ISLKAVSVLRYITDHVERSFSISVVNRLLCTHNVPCVLVQLVDRCPWMRYTEGEVEKYIN
GKWQTIPAEDHLKMTKLDGQVWICLYNLLLKGDYQRKYDFNSFNKNQLLKLRGFLTEVLI
DQLPVLLDLQRFLAHLAVTDPAPPKAGLTLEQLPQIRNHIMRQNSGKWKGIAKYQAKETF
NLSENDLKSQAQSLAQTYNLDVMESLLPEKPKCGFCGNEALKRCSRCQVERYCSRECQVK
HWSKHKKACQMLAEATEVKTSLHTDGNQSDQ
Download sequence
Identical sequences H3DBB2
99883.ENSTNIP00000017804 ENSTNIP00000017804 ENSTNIP00000017804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]