SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017826 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017826
Domain Number 1 Region: 289-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-54
Family SPRY domain 0.0000433
Further Details:      
 
Domain Number 2 Region: 9-87
Classification Level Classification E-value
Superfamily RING/U-box 1.44e-19
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 3 Region: 96-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000366
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017826   Gene: ENSTNIG00000014788   Transcript: ENSTNIT00000018050
Sequence length 476
Comment pep:known_by_projection chromosome:TETRAODON8:11:4991685:5006881:1 gene:ENSTNIG00000014788 transcript:ENSTNIT00000018050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STETTKKKYQLVEDLDELLCSICLSIYQDPVSFGCEHYFCRKCITEHWSRQEPHGTRDCP
ECRRTFLDPLLSPSLKLSNIVERYSAFPLDAILNAQRSSYPCKDHEKVKLFCLTDKSLVC
FFCDEPALHEQHQVTTIDEAYEEIQLFYGIHLSICFLAKGLEASQNCNTEKEYEHTPQWE
KMIGSLPTRFRNCYFHLFKQFLLKQIQRELLVLQREMKEQLAILQDSEKGHTEALQLLQR
QLTETKERLNEGGRHDFLEGVATTEERWPRVLIQDQAKNKTCHVPAKRKVLSLLWLVLTL
DPVTAHQRLILSDDCTIVAYGNLHPQPLQDSPRRFDVEVSVLGAEGLMSGVHYWEVMVSE
KTQWMIGVASETVSRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVKSKLEKVGVY
LDYPKGLLIFYNADDMSWLYTYREKFPAKVFPYFSPGQSHANGKNVQPLRINTVRL
Download sequence
Identical sequences H3DBD4
99883.ENSTNIP00000017826 ENSTNIP00000017826 ENSTNIP00000017826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]