SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017839 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017839
Domain Number 1 Region: 173-295
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000149
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000706
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 125-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017839
Domain Number - Region: 514-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number - Region: 841-890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0257
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 715-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0795
Family Laminin-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017839   Gene: ENSTNIG00000014800   Transcript: ENSTNIT00000018063
Sequence length 1141
Comment pep:novel chromosome:TETRAODON8:11:4772082:4781712:1 gene:ENSTNIG00000014800 transcript:ENSTNIT00000018063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDECQVHNGGCQHRCVNTRGSYYCECHPGSRLHVDGRTCLAVHSCAISNGGCEHYCVQQ
SSTHFLCRCKPNYVLAEDRKHCALQNPCAVQNGGCMHDCRLDGTRPHCVCRVGFILAEDR
KTCQADIDECQTEASNCAHGCHNTLGSYVCVCNAAYELGSDGKQCYRIEMEIVNSCENNN
GGCSHHCQHSTGGPVCSCNHGYRLDNDLKTCIDVDECAEQSSCCEQDCINYPGGYECYCS
AGYRLSSDGCNCDDVDECVAVNGGCEHTCQNSAGSFQCFCRRGFRLDEDRQSCIPLEDVF
EALSSGGATEFPLVQPQLTLVQDYSLPLERYDDYEDDEGELRAESNLAEKFVCLDDTFGN
DCSLTCDDCSNGGKCNQWKSGCDCPDGWTGLICNQTCPEGFFGKNCSFPSKCKNGGSCDP
VTGSCRCPPGVSGEFCQDGCPKGFYGKLCNKRCNCANNGRCHRTYGACLCDPGLYGRFCH
LSCPKWAFGPGCSEECRCVQQNTLECHRRFGTCVCKPGYKGSTCKEECDPGTFGARCESR
CACPAGVSCHHVSGACQRKCPPGLHGESCDQDCPEGTFGAGCAHPCNCSGAVCDPVTGGC
KCPAGTSGEHCENLCPEGSWGPGCTQTCPVCENGGVCHKHNGSCICPPGFMGRLCQNTCP
SGRFGQGCQMKCICENNARCDVASGRCTCAPGWTGHNCRKACDAGRWGTDCAETCDCRNG
DGSCDPVTGQCNCEAGYTGDKCQQKCPTGMFGFGCRHRCQCDNKALCDHVSGACTCQSGW
TGTFCEKPCPRGFYGLDCQEKCLCLNGGSCNHVSGHCSCPAGWIGRSCNLTCPPGSYGGG
CNQTCSCRNSGICHPASGQCACTPGWTGPNCTEACLPGSYGTDCVQRCSCPRGASCHHIS
GECGCPPGLMGNGCEQICKEGRYGPGCEGECRCENGGRCVPSTGACECPPGFIGARCHTA
CPAGHFGPDCAGAAACGEGAPTDPVSGRCLCGPGRRGEDCGHDCPPGWFGVGCLHRCNCS
HGNRCDAATGNCTCGLGWTGARCDEECPAGHFGANCQLRCDCQNNSTCDRVTGTCRCAAG
HYGRQCEHWKTGPRCDLDCRENFYGPDCAETCECENGAQCDPRNGRCSCRHSWIGPACQE
G
Download sequence
Identical sequences H3DBE7
99883.ENSTNIP00000017839 ENSTNIP00000004425 ENSTNIP00000017839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]