SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017843 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017843
Domain Number 1 Region: 138-191
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000932
Family Myb/SANT domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017843
Domain Number - Region: 35-103
Classification Level Classification E-value
Superfamily BRCT domain 0.000112
Family DNA-repair protein XRCC1 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017843   Gene: ENSTNIG00000014804   Transcript: ENSTNIT00000018067
Sequence length 395
Comment pep:known_by_projection chromosome:TETRAODON8:11:4723146:4725850:1 gene:ENSTNIG00000014804 transcript:ENSTNIT00000018067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTMLSKQQDADTSKISPVLFMGVDGKPMSFFLRPSPAKAELQRLIVAGGGVLCSVQQPG
AILLMNPVEGAAIPASTTHWYVSTRFIQDCVEKNEQLDLELYRINPASSPAQNTKENSSG
GMVYNMSATHFGQCLKLGRQPYTAEEDAAILSYVSKYKAETGGNRIWQEMEKERLTSHSW
QSMKYRYRVRLAKQQSEVVEKTAAEGEMLDKGDRVSQKPPNLQNQIDAPSTSAEDMPEEM
LVCPQEEKEAVEPPMDEQPVGHPEETVEADSSDGPQQEPPPPEVADPQTAVSPQEEPRPE
DSSLVQPDLPLLKQSLVSLLKMQLLDLVSVTKALLKTSGDFSEARLLLLDSIGSGQHWHC
SDDDLLMSGDPVVREQLREKYGEEGIAKRIAFLEL
Download sequence
Identical sequences H3DBF1
ENSTNIP00000017843 99883.ENSTNIP00000017843 ENSTNIP00000017843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]