SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017905 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017905
Domain Number 1 Region: 97-212
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-35
Family Ankyrin repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017905   Gene: ENSTNIG00000014863   Transcript: ENSTNIT00000018129
Sequence length 569
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:1777636:1780462:1 gene:ENSTNIG00000014863 transcript:ENSTNIT00000018129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSDPGQSSETWGERLVAPCRIYADKDGPEKKKAKKEAGGKKSQANLLFGYPLSERKQMAL
LMQMTANSPDSTPSHPSQTTPVQKKVPSSTSTRQKDKVNKRNERGETPLHMAAIRGDVKQ
VKELISLGADVNVKDFAGWTPLHEACNLGYYDVAKVLIAAGAEVNTQGLDDDTPLHDASS
SGHKDIVKLLLRHGGNGFQANKRGERPVDVADTQELELLLKGEVPLSDQEDTSSESEDPT
SFNPSSVDDNMEDSDGEKDTESKAPAKASASVPGLDEYEFKDEEEEEDLSKALSDRHIYR
KDLRQRDKDDKDKNHVVGKPSGKGDSISKSKKQKLSHCSSDTSGDEMENFPDKRSSPTCS
QSSESLKMDTRPKKEISEQKEKGKVKRKSKSQSKNKENQEDGKENSKALVLSLATVSESM
EIGREISREEDSFKMSFSPKDDSSVHLFHLSSIKSPKLNHSLTDKQTPLKQENAKLCISI
SDGSAPVDGVKYNHYSEAEYCTEGSSTKACKHKEKSKHQQKDPSADREDEHVHAYKDGSL
ANSLDNPEGAFRKTDGDGKAVKKHKPKHK
Download sequence
Identical sequences H3DBL2
99883.ENSTNIP00000017905 ENSTNIP00000017905 ENSTNIP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]