SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017911 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017911
Domain Number 1 Region: 295-437
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-41
Family Third domain of FERM 0.00000957
Further Details:      
 
Domain Number 2 Region: 187-296
Classification Level Classification E-value
Superfamily Second domain of FERM 7.46e-34
Family Second domain of FERM 0.00000312
Further Details:      
 
Domain Number 3 Region: 106-186
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-26
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017911   Gene: ENSTNIG00000014869   Transcript: ENSTNIT00000018135
Sequence length 903
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:1840551:1854531:-1 gene:ENSTNIG00000014869 transcript:ENSTNIT00000018135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGTDTEAKQPQESKETEKGEAKAAEAASPQNQPVQLPAAAGHSTPARKQQVGASWR
SQPEEQGCGLETEQKDPQDEDQVSHRSSSSRLSKSPLKGAKKVKMMQCKVTLLDNTDYTI
DVEKGARGQMLFDKVCEHLNLLEKDYFGITYRDVENQKNWLDPSKELKKQIRTGPWNFAF
SVKFYPPDPVQLAEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPEE
MGSDYLSELRLAPNQTKELEEKVMELHKSYNCAVRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPPKKFLSLGSKFRYSGRTQAQTRRAS
SQIIRPAPFFERSSSKRYNMSRSLDGAVVEQPASSDASHCDSSADGVARVKGNIITTVTP
ERKAEEENGEQVDSQTDVADNPDPAASTPLKQETKTSSQLIPELTNEDRTATNGVYRTMK
NQHPPRVYTDDPLRSELSLPSSPVSFTKPKGASLTASITQGYLDHDSSEEEEKIEKKKKK
PTSFSSNATRDNKYRETVDNLKIIKTFCRELVLVCLEKQTDSEQTDFAIDGEMTATESTK
FSCLLPLLRCQSEADEESEIQTQETGDGAQGPTEWEKRLSSSPMCSPRFDEAPMIEPLEL
QDEDVSERSVVKVSPGAVTQEVSQAINDKKIIGSDSPKKAMVSWISEEVETVTTKETHDK
PEEKPAVAMETEAAVAKPAEPVVDTNGDFDPGVLLSAQTITSETTSTTTTTHITKTVKGG
ISETRIEKRIVISGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITPEEGKRPP
DAS
Download sequence
Identical sequences H3DBL8
ENSTNIP00000017911 99883.ENSTNIP00000017911 ENSTNIP00000017911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]