SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017919 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017919
Domain Number 1 Region: 38-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-32
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017919   Gene: ENSTNIG00000014876   Transcript: ENSTNIT00000018143
Sequence length 1800
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2086472:2135619:-1 gene:ENSTNIG00000014876 transcript:ENSTNIT00000018143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRWNTRWKTKRWLWDSTLTVAVIVILILQVVTVRAADPVDILKALDFKSSPEGVRKAPG
FCTLRRGGKPDIAYRVSKTAQISTPTKQLFPGGVFPQDFSIMFTIKPKAGLQSFLLSMYN
HQGIQQLGVEVGRGPVFLYEDQHGKPSADEYPLFHSVNLADGKWHRVALSVDKKSVTIIV
DCKKKVTRPLRRSNRAVIDTEGITVFGTRILDEEVFEVRWSMLNQDRAAFLITTGINARL
DIDVRVEKKHIQAKQPARQWHTPITELIKGYTGYEYGEIYDYTEGELTTDAPPTEQAKTE
TQVDGDFYAGEYDYITLDGSQPETGTETTGQGQVVPVETVVPVDTKEEVDPAPNEYEFKE
YDLKEYGTKDFDKTYDYGDQNYEHPDPRPTSAAYEEEFGPGVPAETDIRESDVGRGHSYL
GEKGEKGEPAVIEPGMLVEGPPGPPGHAGVPGTPGLQGPLGPPGDPGARGPPGRPGLPGA
DGVPGLPGTILMLPFRAGGASHKGPVVSAQEAQAQAILSQARLAMRGPPGPGGLMGRSGP
IGGPGAPGLKGDGGDSGPPGPRGLQGPTGPPGKSGKRGRNGADGARGIPGEAGPKGDRGF
DGLPGLPGEKGHRGEQGSTGPPGSPGDDGPRGEDGPVGQRGVAGESGPRGLLGPRGSSGP
AGQPGLPGIDGPPGPKGNMGPQGESGPPGQQGLPGPHGLIGPQGPIGPPGEKGPQGKQGV
AGLAGADGPPGHPGKEVPLARKGAPGPIGSIGYPGPRGVKGADGIRGLKGGKGEKGEDGF
PGFKGDMGLKGDKGENGAQGPRGEDGPEGPKGKSGPGGELGPPGLAGEKGKLGVPGLPGY
PGRQGSKGSNGFPGFPGANGEKGTRGLGGKPGPRGQRGPTGPRGGRGARGPTGKPGAKGT
SGNDGPPGPPGERGPQGPQGPLGFPGPKGPNGPPGKDGLPGHPGQRGETGFQGKTGPPGP
GGVVGPQGPTGGTGPSGERGHPGPPGPPGDQGLPGAAGKEGGKGDPGPQGPSGKAGPPGL
PGFQGQRGLPGGMGQAGLKGGEGPQGPPGPIGSSGERGAAGPGGPIGLTGRNGPQGPPGP
AGEKGAPGEKGDVGPAGRDGIQGPIGLPGSAGPQGQPGEDGDKGEVGGPGQKGSKGDKGE
LGPPGPAGLQGVIGAPGPAGSDGEAGPRGQQGMFGQKGDEGPRGFPGLPGPVGLQGLPGP
PGEKGENGDVGAMGPPGPPGPRGPQGPGGTVGPQGPPGGVGSAGAVGEKGEAGEAGNPGP
QGEPGVMGRKGETGEKGDTGPPGAAGPPGLRGPPGDDGPKGNPGPVGFVGDHGPPGEPGT
AGIDGLPGDKGDDGEPGQPGPPGPSGEAGVPGPPGKRGSVGPAGKEGRQGEKGSKGEAGA
EGPVGKTGPVGPQGPPGKSGPEGLRGIPGPVGEQGLPGASGRDGPPGPLGPPGLPGMKGD
SGSKGEKGHPGLIGLIGPPGEPGEKGDRGLPGLQGTAGGKGDSGAGGFQGPLGPPGPPGL
PGTIGQKGSKGSNGAQGQKGDPGLVGPPGPPGPPGDMIQPLPVQHSNKRSRRQAEMQGAD
AGGRLRRSSGIDDVFGSLNNIKQDIERMKFPMGTQDNPARTCNDLLLSQPDYPDGEYWID
PNQGCTGDAIKVFCNFTAGGETCIYPDKKSAGVRISNWPKETPGSWFSEFKRGKILNYVD
VEDRTITTVQMTFLKLLSSAARQNFTYICHHSVAWYDAKADNYDKARFLGSNDEELSYDN
NPYVKPLTDGCSLKQGYSKTVMEINTPRIDQLPIIDVMLNDFGESNQRFGFEVGSVCFLG
Download sequence
Identical sequences H3DBM6
ENSTNIP00000017919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]