SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017944 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017944
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.71e-24
Family P-domain of calnexin/calreticulin 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017944   Gene: ENSTNIG00000014900   Transcript: ENSTNIT00000018168
Sequence length 78
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2742540:2743034:-1 gene:ENSTNIG00000014900 transcript:ENSTNIT00000018168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEWEPPMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEYSADSTIYKFDSIGILGL
DLWQVKSGTIFDNFVITD
Download sequence
Identical sequences H3DBQ1
ENSTNIP00000017944 99883.ENSTNIP00000017944 ENSTNIP00000017944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]