SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017955 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017955
Domain Number 1 Region: 255-575
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-90
Family Protein kinases, catalytic subunit 0.0000000607
Further Details:      
 
Domain Number 2 Region: 15-100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.61e-27
Family PB1 domain 0.00000647
Further Details:      
 
Domain Number 3 Region: 122-191
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.88e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017955   Gene: ENSTNIG00000014911   Transcript: ENSTNIT00000018179
Sequence length 598
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2913913:2931170:1 gene:ENSTNIG00000014911 transcript:ENSTNIT00000018179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTLRDSTMSHPGENSHQVRVKAYYKGDIMITHFEPSISYEGLYGEVRDMCSMDNDQLFT
MKWIDEEGDPCTVSSQLELEEALRLYELNKDSELIIHVFPCVPENPGMPCPGEDISQSEI
YRRGARRWRKLYYASGHAFQAKRFNPEQRAHCAICADRIWGLGRQGYKCINCKLLVHKKC
HKLVTVECGRPVIQDPVMHDTPSSPGDPSEQPGVPTTQGPRTKDSRENLPDEGEEKEAWR
SREAGKSPSSLGLADFELLRVIGRGSYAKVLLVQLKKTERIYAMKVVKKELVNDDEDIDW
VQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFY
SAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPN
YIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQ
IRIPRSLSVKAASVLKGFLNKDPKERLGCHPQTGFADIMGHPFFRNVDWDLLEQKQMVPP
FKPNISGEFGLDNFDAQFTNEPIQLTPDDDDVVKKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences H3DBR2
99883.ENSTNIP00000017955 ENSTNIP00000017955 ENSTNIP00000017955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]