SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017981 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017981
Domain Number 1 Region: 354-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-79
Family Protein kinases, catalytic subunit 0.00000839
Further Details:      
 
Domain Number 2 Region: 44-121
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.64e-31
Family PB1 domain 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017981   Gene: ENSTNIG00000014935   Transcript: ENSTNIT00000018205
Sequence length 618
Comment pep:known_by_projection chromosome:TETRAODON8:3:14103487:14108095:1 gene:ENSTNIG00000014935 transcript:ENSTNIT00000018205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDERQALHSIMKDLVALQMTRRQPLAPYDSGRAKSPAQANRQDDVRIKFEFSGERRILMF
GRPVQFEEVRQRAETVFGRQLDLHYMNNELSIPLRGQDDLDKAVDLLDRSSNMKSIKIQL
LAQENSKLQASPPRPAPVQPLRTRPSQSTGDASSPFQASEPRGRHLSTGSQNAGRSSPPP
GYVPERQQRIARQGSYTSINSEGEFIPETSDQCMLDPWSSAENSVSGSCQSLDASSDSPS
LRKSRTHRAKSYPDNRQEFSDRENHVYDRVAGKGGTYPRRYHVSVHHKDLSDGRRTFPRI
RRPQGNLFTLVPSRRSLNGSEESLSGWPLADAQCRLRPQERSVAHKSPSAPLTWRRGKLL
GQGAFGRVHLCYDVDTGRELAAKQVQFDPESPETSKEVSALECEIQLLKNLRHERVVQYY
GCLRDHGERTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHGNMIVHR
DIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKA
DVWSLGCTVVEMLTQKPPWAEYEAMAAIFKIATQPTNPPLPSHTSEQARDFVGCIFVEAK
HRPSAEELLRHPFAQIPG
Download sequence
Identical sequences H3DBT8
99883.ENSTNIP00000017981 ENSTNIP00000017981 ENSTNIP00000017981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]