SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018061 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018061
Domain Number 1 Region: 254-430
Classification Level Classification E-value
Superfamily vWA-like 1.06e-24
Family Integrin A (or I) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018061   Gene: ENSTNIG00000014679   Transcript: ENSTNIT00000018285
Sequence length 1091
Comment pep:known_by_projection chromosome:TETRAODON8:11:6496363:6515622:1 gene:ENSTNIG00000014679 transcript:ENSTNIT00000018285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVWRLPLTHACSTSLLLWMFVGWRAAEAAVSQQGIPLSVVKLWASAFGGEIKSISAKY
SGSQLLQKKHKEFVKTVKVEEIDGMKLVKNLAVKMEEVFQKKAEATRRLVEAAEEAHHEH
EENPELQYEYFNAVLINEVDELGNNVELGGEFLLEPNDHFNNLSVNLSLSVVQVPTNMYN
KDPDIVNGVYWSEALNKVFVDNFERDPTLTWQYFGSAKGFFRQYPGVKWHPDEHGVIGFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNQE
IHYVEPCLNGTLVRADRANKDHFREHLDKLFAKGIGLLGEALAEAFTILSDFNRTGRGSV
CSQAIMLVTDGATEMYDDVFEKYNWPERKVRIFPYLIGRESAFADNKWMACANKGYFSQI
STLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAYVDSALNEKVGPSLMTTVAMPVFSTK
NETKNQGILLGVVGTDIPLPELMKLIPKHMLGIHGYAFAITNNGYILTHPDLRPLYQDGQ
KRRKPNYSSVDLSEVEWEDKDDFLRNAMVNRRTGTFSMEVKKTVDRGRRVLKMHNDYYFT
DIKGTPFSVGVALSRGHGKYFFRGNVSVEAGLRDLEQPDVALADEWTYCNTEEKHEHRHL
TQIQAIKLFMTSRRPNLKCDRELIQEVLFDAVVTAPLEAYWTGLALNKSENSDKGVEIAF
LGTRTGLSRTNLFIPADHLSNQDFLTAEDKEGVFNADHFPLWYKRAAEQVPGTFVYSIPF
STAIENKSVVLASTAIQLLDDRKSPIVAAVGIQMKLEFFQRKFWTACRQCMALDGKCSIS
CDSEDINCYLIDNNGFILVTEEHSQTGLFFGEVEGAVMNKLLQMGSFKRITLYDYQALCK
EYTGSSDSARMLSDPFSVVKWLLTEIVIFLLEFNLYSWWNVDLSVKALSAQRTRGKTLMV
PCDTEYPAFVSERTIKETTGNIDCEGCIRSFVIQQIPSSNLFMVVVDNKCDCSSIPPVTM
DPIEIIHNESLKCDRLKFQKDRKKPESCHPFHPEENAMECGSATRLSSALTAALLPLIAA
GVNRCPPPLLA
Download sequence
Identical sequences H3DC18
ENSTNIP00000017708 99883.ENSTNIP00000018061 ENSTNIP00000018061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]