SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018063 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018063
Domain Number 1 Region: 161-339
Classification Level Classification E-value
Superfamily vWA-like 2.36e-25
Family Integrin A (or I) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018063   Gene: ENSTNIG00000015012   Transcript: ENSTNIT00000018287
Sequence length 1003
Comment pep:known_by_projection chromosome:TETRAODON8:9:4940231:4988009:1 gene:ENSTNIG00000015012 transcript:ENSTNIT00000018287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMFHKKAQAMKRLVEAAEDAHQQHVEDPDLLKYEYFNAVLINEVDEVGNSVELGGEFI
LQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQY
FGSAKGFFRQYPGIKWRPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLT
IARQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDKLFAQ
GIGMLDVALTEAFSLLRDFNETGRGSDCSQAIMLVTDGAVDTYDTIFAKYNWPERKVRIF
PYLIGRESAFAENLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDTVWT
EAYIDSTLPQAQKLDDGQGPVLMTTVAMPVFSTKNETRNHGILLGVVGTDVPVSELLKTI
PKHKIGWALHGYAFAITNNGYILTHPDLRPLYGDGKKRRKPNYSSVDLSEVEWEDKDDML
RNAMVNRKTGTFSMEVKKSVDKGKRVLELHNDYYYTDIKGTPFSFVLLFSRGHGKFFFRG
NVTVEEGLHDLEHPDVALADEWTYCNTDEHPEHRYLTQMEAIKLYLNGYEPHLHCDKVLV
QEVLFDAVVTAPLEAYWTSLVLNKSENSDKGVEIAYLGTRTGLSRINLFVVPDELTNQDF
LTAEDKEGVFNADHFPLWYKRAAEQVPGTFIYSLPFNTASENRSVVLASTAIQLLDERKS
PIAAAVGIQMKLEFFQRKFWTASKQCAALDGKCSISCDDENINCYLIDNNGFILVAEDYT
LLDGQIFWGTEGAVMSKLLQMGSFKRVTLYDYQALCWVYSESSGSGHALLDPYFALLSAV
KWILTELVIFLVEFNLCSWWYSDLTAKAQRMGRSMQVPCDTEFPAFISERTIKENTGHVD
CDGCIKSFVIQQIPSSNLFMVVVDNKCDCSMFEPITMNPVEIITSHNESLKCERLKMQKH
RRRPDTCHPFHPEENAMECGGATHLVPSAMATLFYVLLVLLYR
Download sequence
Identical sequences H3DC20
ENSTNIP00000018063 99883.ENSTNIP00000018063 ENSTNIP00000018063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]